The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG
TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI
VERLGDYLVEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A0A0REA1 Koc s 2.0101 133 915 237.8 7.6e-65
ACS34771 Sal k 4.0101 133 880 228.9 3.5e-62
A0A0A0RCW1 Aca f 2 133 856 222.9 2.3e-60
A0A023W2L7 Pro j 2.0101 133 855 222.6 2.8e-60
ACP43298 Ama r 2.0101 133 844 219.9 1.9e-59
A0A2I4DNN6 Jug r 7.0101 131 780 203.7 1.4e-54
AAL29690 Lyc e 1 131 776 202.7 2.7e-54
AJ421030 Art v 4.0101 133 775 202.4 3.3e-54
Q9M7N0 Hev b 8.0201 131 772 201.7 5.5e-54
AAL07320 Lit c 1 131 768 200.7 1.1e-53
O24169 Ole e 2 134 762 199.2 3.2e-53
Q9M7M8 Hev b 8.0203 131 761 198.9 3.8e-53
O65812 Hev b 8.0101 131 760 198.7 4.5e-53
AAL92870 Che a 2 131 759 198.4 5.4e-53
ADK22841 Sal k 4.0201 133 759 198.4 5.4e-53
O81982 Hel a 2 133 758 198.1 6.5e-53
Q9XF38 Pyr c 4 131 754 197.1 1.3e-52
Q9LEI8 Hev b 8.0204 131 754 197.1 1.3e-52
O24170 Ole e 2 134 752 196.6 1.9e-52
CAD10376 Cap a 2 131 751 196.4 2.2e-52
CAD37201 Pru p 4.0101 131 750 196.1 2.6e-52
O49894 Mer a 1 133 750 196.1 2.6e-52
AY081850 Pru du 4.0101 131 749 195.9 3.1e-52
AY081852 Pru du 4.0102 131 749 195.9 3.1e-52
AJ421031 Art v 4.0201 133 749 195.9 3.1e-52
QVU02258 Que ac 2.0101 133 748 195.6 3.7e-52
Q9M7M9 Hev b 8.0202 131 747 195.4 4.4e-52
O24171 Ole e 2 134 747 195.4 4.5e-52
Q9XF40 Mal d 4 131 746 195.1 5.2e-52
Q9XF39 Pru av 4 131 743 194.4 8.8e-52
QRN65366 Lig v 2.0101 134 742 194.1 1.1e-51
Q9XF42 Mal d 4 131 739 193.4 1.8e-51
O65809 Gly m 3 131 738 193.1 2.1e-51
Q9STB6 Hev b 8.0102 131 736 192.6 3e-51
AAP13533 Cuc m 2 131 735 192.3 3.6e-51
P25816 Bet v 2 133 734 192.1 4.3e-51
P84177 Cit s 2.0101 131 732 191.6 6e-51
O65810 Gly m 3 131 731 191.3 7.2e-51
XP030492464 Can s 2.0101 133 730 191.1 8.7e-51
P35079 Phl p 12.0101 131 729 190.8 1e-50
CAA54686 Phl p 12.0101 131 729 190.8 1e-50
Q5XWE1 Citr l 2.0101 131 729 190.8 1e-50
Q9FUD1 Ory s 12.0101 131 727 190.3 1.4e-50
O24650 Phl p 12.0102 131 727 190.3 1.4e-50
CAD37202 Pru p 4.0201 131 725 189.8 2.1e-50
O04725 Cyn d 12 131 724 189.6 2.4e-50
Q9FR39 Zea m 12.0105 131 724 189.6 2.4e-50
P35081 Zea m 12.0101 131 723 189.3 2.9e-50
AAL76933 Dau c 4 134 721 188.8 4.2e-50
Q9XF37 Api g 4 134 720 188.6 5e-50
P52184 Hor v 12.0101 131 719 188.3 5.9e-50
ABU95412 Sin a 4.0101 131 718 188.1 7e-50
Q9XF41 Mal d 4 131 717 187.8 8.3e-50
P35083 Zea m 12.0103 131 716 187.5 9.9e-50
FM164277 Tri a 12.0104 131 716 187.5 9.9e-50
CAD10377 Lyc e 1 131 715 187.3 1.2e-49
Q93YG7 Sola l 1.0101 131 715 187.3 1.2e-49
QID21357 Pop n 2.0101 131 712 186.5 2e-49
O22655 Zea m 12.0104 131 712 186.5 2e-49
P49232 Tri a 12.0101 138 711 186.3 2.5e-49
P49233 Tri a 12.0102 141 711 186.3 2.5e-49
Q8L5D8 Pho d 2.0101 131 710 186.0 2.8e-49
O24282 Phl p 12.0103 131 708 185.5 4e-49
Q42449 Ara t 8 131 707 185.3 4.8e-49
Q9AXH4 Cor a 2 131 706 185.0 5.7e-49
AAK54835 Ana c 1 131 702 184.0 1.1e-48
Q9SQI9 Ara h 5 131 702 184.0 1.1e-48
AAK01235 Cor a 2 131 700 183.5 1.6e-48
P49234 Tri a 12.0103 140 699 183.3 2.1e-48
AF377948 Mus a 1.0101 131 694 182.0 4.6e-48
P35082 Zea m 12.0102 131 691 181.2 7.9e-48
Q9XG85 Par j 3 132 683 179.2 3.2e-47
Q5EF31 Cro s 1.0101 131 678 178.0 7.6e-47
Q9T0M8 Par j 3 131 676 177.5 1.1e-46
FG438715 Act d 9.0101 109 619 163.1 1.9e-42
QEQ43417 Sola m 1.0101 159 498 132.5 4.3e-33
A0A1B2YLJ4 Tyr p 36.0101 131 270 75.0 7.6e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 237.8 bits 915,  Expect = 8e-65
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 2. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 228.9 bits 880,  Expect = 3e-62
 Identities = 127/133 95%, Positives = 130/133 97%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMC+IEGT NHLT AAILGVDGSVWAQSANFPQFKPDEI+A+VKEFDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 3. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 222.9 bits 856,  Expect = 2e-60
 Identities = 121/133 90%, Positives = 128/133 96%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            M WQTYVDDHLMC+IEGT NHL+GAAILGVDGSVWAQSA+FPQFKPDEIAA+VK+FD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGE G+ IRGKKGPGGICVKKTGQAL+FGIYDEPVTPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 4. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 222.6 bits 855,  Expect = 3e-60
 Identities = 122/133 91%, Positives = 128/133 96%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMC+IEGT NHL+ AAILGVDGSVWAQSA+FPQFKPDEI+A+VK+FD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGE GQVIRGKKGPGGICVKKTGQALI GIYDEPVTPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 5. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 219.9 bits 844,  Expect = 2e-59
 Identities = 120/132 90%, Positives = 127/132 96%, Gaps = 0/132 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMC+IEGTTNHLTGAAILG+DGSVWAQSA+FPQFKPDEIAAIV++FDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGE G VIRGKKG GGICVKKTGQAL+ GIYDEPVTPGQCNMI
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  121  VERLGDYLVEQG 132
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 6. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 203.7 bits 780,  Expect = 1e-54
 Identities = 113/131 86%, Positives = 125/131 95%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMC+I+G   HLT AAI+G DGSVWAQS++FPQFKP+EIAAI+K+FDEPG
Sbjct  1    MSWQTYVDEHLMCEIDG--QHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGEAG VIRGKKG GGI VKKTGQALIFGIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 7. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 202.7 bits 776,  Expect = 3e-54
 Identities = 113/131 86%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMCDIEG  NHLT AAI+G DGSVWAQSANFPQFKP+EI AI+ +F EPG
Sbjct  1    MSWQTYVDDHLMCDIEG--NHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGEAG VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDY++EQG+
Sbjct  119  VERLGDYIIEQGL 131

Sequence Alignment: 8. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 202.4 bits 775,  Expect = 3e-54
 Identities = 107/133 80%, Positives = 121/133 90%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMCDIEGT  HLT AAI+G DG+VWA+SA+FP+FKP+EI AI+KEF+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LGG KYMVIQGEAG VIRGKKG GGIC+KKTGQA++FGIYDEPV PGQCNM+
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYL++QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 9. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 201.7 bits 772,  Expect = 6e-54
 Identities = 111/131 84%, Positives = 124/131 94%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMCDI+G  +HLT AAI+G DGSVWAQS++FPQFKP+E+AAI+K+FDEPG
Sbjct  1    MSWQTYVDEHLMCDIDG--HHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGE G VIRGKKG GGI VKKTGQALI GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 10. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 200.7 bits 768,  Expect = 1e-53
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMC+ +G   HLT AAI+G DGSVWAQSANFPQFKP EIAAI+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCETDG--QHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGE G VIRGKKGPGGI VKKT QALI GIYDEP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYLV+QG+
Sbjct  119  VERLGDYLVDQGL 131

Sequence Alignment: 11. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 199.2 bits 762,  Expect = 3e-53
 Identities = 109/133 81%, Positives = 120/133 90%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNH-LTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEP 59
            MSWQ YVDDHLMCDIEG  +H LT AAI+G DGSVWAQSA FPQFKP+E+  I+ +F+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNM 119
            G LAPTGLHLGGTKYMVIQGEAG VIRGKKG GGI +KKTGQAL+FGIY+EPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLVEQGM 133
            +VERLGDYLVEQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 12. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 198.9 bits 761,  Expect = 4e-53
 Identities = 110/131 83%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMCDI+G  + LT AAI+G DGSVWAQS+ FPQFK DE+AA++K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGE G VIRGKKG GGI VKKTGQALI GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 13. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 198.7 bits 760,  Expect = 4e-53
 Identities = 110/131 83%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+ LMC+IEG  NHLT AAI+G DGSVWAQS+NFPQFK +EI AI+ +FDEPG
Sbjct  1    MSWQTYVDERLMCEIEG--NHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGLHLGGTKYMVIQGEAG VIRGKKGPGG+ V+KT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 14. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 198.4 bits 759,  Expect = 5e-53
 Identities = 106/131 80%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMCDIEG  NHL+ AAILG DG+VWAQS +FPQ+KP+E++AI+K+F+EPG
Sbjct  1    MSWQTYVDDHLMCDIEG--NHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGE G VIRGKKGPGG+ +KKT QALI GIY EP+TPGQCNM+
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VER+GDYLVEQGM
Sbjct  119  VERIGDYLVEQGM 131

Sequence Alignment: 15. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 198.4 bits 759,  Expect = 5e-53
 Identities = 106/133 79%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVD+HLMC+IE T NHLT +AI+GVDGS+WAQS+NFPQ KP EI AI KEFD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL LGG KYMVIQGE G VIRGKKGPGG+C+KKT QALIFGIYDEPV PGQCNM+
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 16. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 198.1 bits 758,  Expect = 6e-53
 Identities = 104/133 78%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVD+HLMCDIEGT  HLT AAILG+DG+VWAQSA FPQFKP+E+  I+KEFDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTG+ + G KYMV+QGE G VIRGKKG GGIC+KKTGQA+I GIYDEPV PGQCNM+
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 17. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 197.1 bits 754,  Expect = 1e-52
 Identities = 106/131 80%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMCDI+G  +HLT AAILG DGSVWAQS+ FP+FKP+EI AI+K+FDEPG
Sbjct  1    MSWQAYVDDHLMCDIDG--HHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGE G VIRGKKG GG+ VKKT QAL+FGIY+EP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 18. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 197.1 bits 754,  Expect = 1e-52
 Identities = 108/131 82%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMCDI+G  + LT AAI+G DGSVWAQS++FPQFK DE+AA++K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGE G VIRGKKG GGI VKKTGQALI GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLLDQGL 131

Sequence Alignment: 19. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 196.6 bits 752,  Expect = 2e-52
 Identities = 107/133 80%, Positives = 119/133 89%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNH-LTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEP 59
            MSWQ YVDDHLMCDIEG   H LT AAI+G DGSVWAQSA FPQFKP+E+  I+ +F+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNM 119
            G LAPTGLHLGGTKYMVIQGEAG VIRGKKG GGI +KKTGQAL+FGIY+EPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLVEQGM 133
            +VERLGDYL+EQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 20. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 196.4 bits 751,  Expect = 2e-52
 Identities = 110/131 83%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMC+IEG  N LT AAI+G DGSVWAQSA FPQFKP+EI AI+ +F EPG
Sbjct  1    MSWQTYVDDHLMCEIEG--NRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL+LGGTKYMVIQGEAG VIRGKKGPGGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQ +
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 21. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 196.1 bits 750,  Expect = 3e-52
 Identities = 110/131 83%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMCDI+G  N LT AAILG DGSVW+QSA FP FKP+EIAAI+K+FD+PG
Sbjct  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGEAG VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 22. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 196.1 bits 750,  Expect = 3e-52
 Identities = 103/133 77%, Positives = 120/133 90%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMCDI+G   HL  A+I+G DGS+WAQSA+FPQ+KP+EI  I+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL++ GTKYMVIQGE+G VIRGKKG GGI +KKTGQAL+FGIY+EPVTPGQCNM+
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 23. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 195.9 bits 749,  Expect = 3e-52
 Identities = 110/131 83%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMCDI+G  N LT AAILG DGSVW+QSA FP FKP+EIAAI+K+FD+PG
Sbjct  1    MSWQQYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGEAG VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 24. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 195.9 bits 749,  Expect = 3e-52
 Identities = 110/131 83%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMCDI+G  N LT AAILG DGSVW+QSA FP FKP+EIAAI+K+FD+PG
Sbjct  1    MSWQQYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGEAG VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 25. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 195.9 bits 749,  Expect = 3e-52
 Identities = 104/133 78%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMCDIEGT  HLT AAILG+DG+VWA+S  FP+FKP+E+  I+ EF+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL LGG KYMV+QGEAG VIRGKKG GGIC+KKTGQA++ GIYDEPV PGQCNMI
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYLV+Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 26. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 195.6 bits 748,  Expect = 4e-52
 Identities = 104/133 78%, Positives = 120/133 90%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMCDI+G   HL  AAI+G DGSVWAQS+NFPQFK +EI+ I+K+F+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGLHLGGTKYMVIQGEAG VIRGKKG GG+ +KKT QAL+FGIY+EPVTPGQCNM+
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 27. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 195.4 bits 747,  Expect = 4e-52
 Identities = 109/131 83%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMCDI+G  + LT AAI+G DGSVWAQS++FPQFK DE+AAI+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIDG--HRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGLHLG TKYMVIQGE G VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 28. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 195.4 bits 747,  Expect = 4e-52
 Identities = 106/133 79%, Positives = 118/133 88%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNH-LTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEP 59
            MSWQ YVDDHLMCDIEG   H LT AAI+G DGSVWAQSA FPQFKP+E+  I+ +F+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNM 119
            G LAPTGLHLGGTKYMVIQGEAG VIRGKKG GGI +KKTGQAL+FGIY+EPVTPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLVEQGM 133
            + ERLGDYL+EQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 29. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 195.1 bits 746,  Expect = 5e-52
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDD LMCDI+G  +HLT AAILG DGSVWA+S+ FP+FKP+EI AI+K+FDEPG
Sbjct  1    MSWQAYVDDRLMCDIDG--HHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGLHLGGTKYMVIQGE G VIRGKKG GG+ VKKTGQAL+FGIY+EP+TPGQCNMI
Sbjct  59   SLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 30. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 194.4 bits 743,  Expect = 9e-52
 Identities = 109/131 83%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMCDI+G  N LT AAILG DGSVW+QSA FP FKP+EIAAI+K++D+PG
Sbjct  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGEAG VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 31. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 194.1 bits 742,  Expect = 1e-51
 Identities = 107/133 80%, Positives = 118/133 88%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNH-LTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEP 59
            MSWQ YVDDHLMCDIEG  +H LT AAI+G DGSVWAQSA FPQFKP+EI  I+ +F+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNM 119
            GTLAPTGLHLGGTKYMVIQGEAG VIRGKKG GGI +KKT QAL+FGIY+EPVTPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  120  IVERLGDYLVEQGM 133
            +V RLGD LV+QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 32. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 193.4 bits 739,  Expect = 2e-51
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMCDI+G  N LT AAILG DGSVW+QSA+FP FKP+EIAAI+K+FD+PG
Sbjct  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKT QAL+ GIYDEPVTPGQCN++
Sbjct  59   TLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 33. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 193.1 bits 738,  Expect = 2e-51
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHL+CDIEG  NHLT AAI+G DGSVWAQS +FPQFKP+EI AI+ +F+EPG
Sbjct  1    MSWQAYVDDHLLCDIEG--NHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKKTG ALI GIYDEP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQG 132
            VER GDYL++QG
Sbjct  119  VERPGDYLIDQG 130

Sequence Alignment: 34. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 192.6 bits 736,  Expect = 3e-51
 Identities = 105/130 80%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMC+IEG  NHL+ AAI+G DGSVWAQSANFPQFK +EI  I+ +F EPG
Sbjct  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL++GGTKYMVIQGE G VIRGKKGPGG+ VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 35. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 192.3 bits 735,  Expect = 4e-51
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVD+HLMC+IEG  NHLT AAI+G DGSVWAQS NFPQ+KP+E+A IV +F +PG
Sbjct  1    MSWQVYVDEHLMCEIEG--NHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL++GGTKYMVIQGE G VIRGKKGPGG+ VKKTG AL+ GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 36. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 192.1 bits 734,  Expect = 4e-51
 Identities = 101/133 75%, Positives = 119/133 89%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMCDI+G  ++   +AI+G DGSVWAQS++FPQFKP EI  I+K+F+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGLHLGG KYMVIQGEAG VIRGKKG GGI +KKTGQAL+FGIY+EPVTPGQCNM+
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYL++QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 37. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 191.6 bits 732,  Expect = 6e-51
 Identities = 108/131 82%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMCDI+G  N LT AAILG DGSVW+QSA FP F+ +EIAAI+K+FD+PG
Sbjct  1    MSWQAYVDDHLMCDIDG--NRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL LGGTKYMVIQGEAG VIRGKKG GGI VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 38. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 191.3 bits 731,  Expect = 7e-51
 Identities = 103/130 79%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHL+C IEG  NHLT AAI+G DGSVW QS +FPQFKP+EI AI+ +F+EPG
Sbjct  1    MSWQAYVDDHLLCGIEG--NHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKKTG ALI GIYDEP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 39. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 191.1 bits 730,  Expect = 9e-51
 Identities = 102/133 76%, Positives = 117/133 87%, Gaps = 0/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMCDI+G   HLT AAI+G DGS+WAQS++FPQ+K  EI  I K+F+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGLHL GTKYMVIQGE G VIRGKKG GG+ +KKTGQALIFGIY+EPVTPGQCNM+
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  121  VERLGDYLVEQGM 133
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 40. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 190.8 bits 729,  Expect = 1e-50
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMC+IEG  +HL  AAILG DG+VWAQSA+FPQFKP+EI  I+K+FDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTG+ + G KYMVIQGE G+VIRGKKG GGI +KKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 41. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 190.8 bits 729,  Expect = 1e-50
 Identities = 103/131 78%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMC+IEG  +HL  AAILG DG+VWAQSA+FPQFKP+EI  I+K+FDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTG+ + G KYMVIQGE G+VIRGKKG GGI +KKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 42. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 190.8 bits 729,  Expect = 1e-50
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMC+IEG  NHLT AAI+G DGSVWA+S NFPQ+KP+EI  I+ +F+EPG
Sbjct  1    MSWQAYVDDHLMCEIEG--NHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL++GG+KYMVIQGE G VIRGKKGPGG+ VKKT  AL+ GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 43. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 190.3 bits 727,  Expect = 1e-50
 Identities = 105/131 80%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMC+IEG  +HLT AAI+G DG+VWAQSA FPQFKP+E+  I+K+FDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LG TKYMVIQGE G VIRGKKG GGI VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 44. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 190.3 bits 727,  Expect = 1e-50
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMC+IEG  +HL  AAILG DG+VWAQSA+FPQFKP+EI  I+K+FDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTG+ + G KYMVIQGE G VIRGKKG GGI +KKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 45. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 189.8 bits 725,  Expect = 2e-50
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMC+IEG  NHL+ AAI+G DGSVWAQSA FPQ+KP+E+  I+ +F+EPG
Sbjct  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKK+  AL+ GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 46. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 189.6 bits 724,  Expect = 2e-50
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMC+IEG  +HLT AAI+G DG+VWAQSA FP FKP+E+A I+K+FDEPG
Sbjct  1    MSWQAYVDDHLMCEIEG--HHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LG TKYMVIQGE G VIRGKKG GG+ VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  59   FLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            +E+LGDYL+EQGM
Sbjct  119  IEKLGDYLIEQGM 131

Sequence Alignment: 47. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 189.6 bits 724,  Expect = 2e-50
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHL+CDIEG   HL+ AAI+G DGSVWAQS NFP++KP+E+A ++K+FDEPG
Sbjct  1    MSWQAYVDDHLLCDIEG--QHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL +GGTKYMVIQGE G VIRGKKG GGI +KKTG +LI GIYDEP+TPGQCNM+
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 48. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 189.3 bits 723,  Expect = 3e-50
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMC+IEG  +HLT AAI+G DG+ WAQS  FP+FKP+E+AAI+K+FDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI VKKTGQ+LI GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 49. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 188.8 bits 721,  Expect = 4e-50
 Identities = 100/133 75%, Positives = 118/133 88%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNH-LTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEP 59
            MSWQTYVDDHLMC+++G   + L+ AAI+G DGSVWAQS+ FP+FKP+EI  I+K FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNM 119
            G LAPTGL+LGGTKYMVIQGE   VIRGKKG GG+ +KKTGQAL+FG+YDEPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  120  IVERLGDYLVEQGM 133
            IVERLGDYL+EQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 50. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 188.6 bits 720,  Expect = 5e-50
 Identities = 100/133 75%, Positives = 117/133 87%, Gaps = 1/133 0%
Query  1    MSWQTYVDDHLMCDIEGTTNH-LTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEP 59
            MSWQ YVDDHLMC++EG   + LT AAI+G DGSVWAQS+ FPQ KP+EIA I+K+FDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  60   GTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNM 119
            G LAPTGL+LGG KYMVIQGE   VIRGKKG GG+ +KKTGQAL+FG+YDEPVTPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  120  IVERLGDYLVEQGM 133
            IVERLGDYL++QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 51. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 188.3 bits 719,  Expect = 6e-50
 Identities = 104/130 80%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHL C+I+G   HLT AAILG DG VW QS NFPQFKP+EIA I+K+FDEPG
Sbjct  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKTG  LI+GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYLVEQG
Sbjct  119  VERLGDYLVEQG 130

Sequence Alignment: 52. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 188.1 bits 718,  Expect = 7e-50
 Identities = 102/131 77%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMCD+EG  N LT AAILG DGSVWAQSANFPQ+KP+EI  I  +F EPG
Sbjct  1    MSWQTYVDDHLMCDVEG--NRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL +GGTKYMVIQGE   VIRGKKG GG+ +KKT QA++FGIY+EP+TPGQCNM+
Sbjct  59   TLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 53. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 187.8 bits 717,  Expect = 8e-50
 Identities = 99/131 75%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMC+IEG  NHL+ AAI+G +GSVWAQSA FPQ+KP+E+  I+ +F+EPG
Sbjct  1    MSWQAYVDDHLMCEIEG--NHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKK+  AL+ GIYDEP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  119  VERLGDYLIEQGL 131

Sequence Alignment: 54. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 187.5 bits 716,  Expect = 1e-49
 Identities = 102/131 77%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMC+IEG  +HL+ AAI+G DG+VWAQS  FPQFKP+E+  I+K+FDEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAP GL LG TKYMVIQGE G VIRGKKG GGI VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQG+
Sbjct  119  VERLGDYLVEQGL 131

Sequence Alignment: 55. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 187.5 bits 716,  Expect = 1e-49
 Identities = 103/130 79%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSW+ YVDDHL C+I+G   HLT AAILG DGSVWAQS NFPQFKP+EIA IVK+F+EPG
Sbjct  1    MSWKAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKTG ALI+GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 56. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 187.3 bits 715,  Expect = 1e-49
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HL+C+ EG  NHLT AAI+G DG+VWAQSANFPQFKP+EI  I+ +F  PG
Sbjct  1    MSWQTYVDEHLLCENEG--NHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL+LGGTKYMVIQGE   VIRGKKGPGGI +KKT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQ +
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 57. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 187.3 bits 715,  Expect = 1e-49
 Identities = 103/131 78%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HL+C+ EG  NHLT AAI+G DG+VWAQSANFPQFKP+EI  I+ +F  PG
Sbjct  1    MSWQTYVDEHLLCENEG--NHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL+LGGTKYMVIQGE   VIRGKKGPGGI +KKT QALI GIYDEP+TPGQCNMI
Sbjct  59   TLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQ +
Sbjct  119  VERLGDYLIEQSL 131

Sequence Alignment: 58. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 186.5 bits 712,  Expect = 2e-49
 Identities = 102/131 77%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMCDIEG  N LT AAI+G DGSVWA SA+FPQF  +E++AI+K+F+EPG
Sbjct  1    MSWQVYVDDHLMCDIEG--NTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL LGGTKYMVIQGE G VIRGKKG GG+ VKKT QALI G+YDEP+TPGQCNMI
Sbjct  59   SLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 59. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 186.5 bits 712,  Expect = 2e-49
 Identities = 99/130 76%, Positives = 117/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVD+HLMC+IEG   HL+ AAI+G DGSVWAQS +FP++KP+E+A I+K+FDEPG
Sbjct  1    MSWQAYVDEHLMCEIEG--QHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            TLAPTGL +GGTKYMVIQGE G VIRGKKG GGI +KKTG +LI G+YDEP+TPGQCNM+
Sbjct  59   TLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 60. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 186.3 bits 711,  Expect = 2e-49
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHL C+I+G   HLT AAILG DGSVW +S NFP+FKP+EIA IVK+F+EPG
Sbjct  1    MSWQTYVDDHLCCEIDG--QHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKTG ALI+GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 61. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 186.3 bits 711,  Expect = 3e-49
 Identities = 102/130 78%, Positives = 116/130 89%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHL C+I+G   HLT AAILG DGSVWA+S NFP+FKP+EIA IVK+F+EPG
Sbjct  1    MSWQAYVDDHLCCEIDG--QHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKTG ALI+GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 62. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 186.0 bits 710,  Expect = 3e-49
 Identities = 101/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVD+HLMC+I+G  +HLT AAILG DGSVWAQS++FPQFK +EI  I+ +F+EPG
Sbjct  1    MSWQAYVDEHLMCEIDG--HHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL+LG TKYMVIQGE G VIRGKKG GG+ VKKT QALIFGIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLIEQGM 131

Sequence Alignment: 63. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 185.5 bits 708,  Expect = 4e-49
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMC+IEG  +HL  AAI+G DG+VWAQSA+FPQFKP+EI  I+K++DEPG
Sbjct  1    MSWQTYVDEHLMCEIEG--HHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTG+ +   KYMVIQGE G VIRGKKG GGI +KKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  59   HLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYLVEQGM
Sbjct  119  VERLGDYLVEQGM 131

Sequence Alignment: 64. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 185.3 bits 707,  Expect = 5e-49
 Identities = 100/128 78%, Positives = 112/128 87%, Gaps = 2/128 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ+YVDDHLMCD+EG  NHLT AAILG DGSVWAQSA FPQ+KP EI  I K+F+EPG
Sbjct  1    MSWQSYVDDHLMCDVEG--NHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LGG KYMVIQGE G VIRGKKGPGG+ +KKT QAL+FG YDEP+T GQCN++
Sbjct  59   FLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLV 118
Query  121  VERLGDYLVE 130
            VERLGDYL+E
Sbjct  119  VERLGDYLIE 128

Sequence Alignment: 65. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 185.0 bits 706,  Expect = 6e-49
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ Y D+HLMC+IEG  N L  AAI+G DGSVWAQS+ FPQ+KP+EI  ++ +F+EPG
Sbjct  1    MSWQAYGDEHLMCEIEG--NRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGE G VIRGKKGPGG+ VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 66. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 184.0 bits 702,  Expect = 1e-48
 Identities = 100/130 76%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMC+I+G   HL+ AAILG D +VWAQS NFPQFKP+EI+AI+ +F+ PG
Sbjct  1    MSWQAYVDDHLMCEIDG--QHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGE G VIRGKKG GGI VKKT  ALI G+YDEP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLLEQG 130

Sequence Alignment: 67. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 184.0 bits 702,  Expect = 1e-48
 Identities = 97/131 74%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HL+C+IEG  +HL+ AAILG DG VWAQS++FPQFKP+EI AI+ +F EPG
Sbjct  1    MSWQTYVDNHLLCEIEG--DHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGE G +I GKKGPGG+ ++KT QALI GIYD+P+TPGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL++ G+
Sbjct  119  VERLGDYLIDTGL 131

Sequence Alignment: 68. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 183.5 bits 700,  Expect = 2e-48
 Identities = 99/131 75%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTY D+HLMC+IEG  N L  AAI+G DGSVWAQS+ FPQ+KP+EI  ++ +F+EPG
Sbjct  1    MSWQTYGDEHLMCEIEG--NRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGE G VIR KKGPGG+ VKKT QALI GIYDEP+TPGQCNMI
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMI 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL++QG+
Sbjct  119  VERLGDYLIDQGL 131

Sequence Alignment: 69. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 183.3 bits 699,  Expect = 2e-48
 Identities = 101/130 77%, Positives = 115/130 88%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSW+ YVDDHL C+I+G   +LT AAILG DGSVWAQS NFPQFKP+E A IVK+F+EPG
Sbjct  1    MSWKAYVDDHLCCEIDG--QNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGE G VIRGKKG GGI +KKTG ALI+GIYDEP+TPGQCN++
Sbjct  59   HLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL++QG
Sbjct  119  VERLGDYLIDQG 130

Sequence Alignment: 70. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 182.0 bits 694,  Expect = 5e-48
 Identities = 100/130 76%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHL+CDI+G    LT AAI+G DGSVWAQS  FPQ KP+EIAAI+K+FDEPG
Sbjct  1    MSWQAYVDDHLLCDIDGQC--LTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTGL+LGGTKYMVIQGE G VIRGKKG GG+ +KKT  ALI GIY+EP+TPGQCNM+
Sbjct  59   SLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL +QG
Sbjct  119  VERLGDYLFDQG 130

Sequence Alignment: 71. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 181.2 bits 691,  Expect = 8e-48
 Identities = 99/131 75%, Positives = 114/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVD+HLMC+IEG  +HL  AAI+G DG+ WAQS  FP+FK +++A I+K+FDEPG
Sbjct  1    MSWQAYVDEHLMCEIEG--HHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LG TKYMVIQGE G VIRGKKG GGI VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  59   HLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 72. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 179.2 bits 683,  Expect = 3e-47
 Identities = 96/132 72%, Positives = 113/132 85%, Gaps = 1/132 0%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMCD+ G  N    AAI+G DGSVWAQSANFPQ+KP+E+  I+ +F+E G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAG 59
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGE+G VIRGKKG GG  +KKTGQA++ GIYDEP+TPGQCN++
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 119
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQG+
Sbjct  120  VERLGDYLLEQGL 132

Sequence Alignment: 73. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 178.0 bits 678,  Expect = 8e-47
 Identities = 94/130 72%, Positives = 114/130 87%, Gaps = 2/130 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVD+HLMCD++G    LT AAILG DGSVWAQSA FP++KP EI AI+ +F+EPG
Sbjct  1    MSWQTYVDEHLMCDMDGHV--LTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
            +LAPTG+++ G KYMVIQGE G VIRGKKG GG+ +KK+  ALIFG+YDEP+TPGQCN++
Sbjct  59   SLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLV 118
Query  121  VERLGDYLVEQG 132
            VERLGDYL+EQG
Sbjct  119  VERLGDYLIEQG 130

Sequence Alignment: 74. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 177.5 bits 676,  Expect = 1e-46
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQ YVDDHLMCD+ G  N L  AAI+G DGSVWAQSANFPQ+KP+E+  I+ +F+E G
Sbjct  1    MSWQAYVDDHLMCDV-GDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGG 59
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
             LAPTGL LGGTKYMVIQGE+G VI GKKG GG  +KKTGQA++ GIYDEP+TPGQCN++
Sbjct  60   FLAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLV 118
Query  121  VERLGDYLVEQGM 133
            VERLGDYL+EQGM
Sbjct  119  VERLGDYLLEQGM 131

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 163.1 bits 619,  Expect = 2e-42
 Identities = 90/109 82%, Positives = 100/109 91%, Gaps = 2/109 1%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
            MSWQTYVDDHLMC+IEG  N+LT AAI+G DGS+WAQSA+FPQFKP+EI AI+ +F EPG
Sbjct  1    MSWQTYVDDHLMCEIEG--NYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPG 58
Query  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEP 111
            TLAPTGL+LGGTKYMVIQGEAG VIRGKKGPGG+ VKKT QALI GIYDEP
Sbjct  59   TLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 132.5 bits 498,  Expect = 4e-33
 Identities = 104/130 80%, Positives = 116/130 89%, Gaps = 30/130 23%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQ----------------- 43
            MSWQTYVDDHLMCD+EG  +HL  AAILG DGSVWAQS  FP+                 
Sbjct  1    MSWQTYVDDHLMCDLEG--HHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCY 58
Query  44   -----------FKPDEIAAIVKEFDEPGTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPG 92
                       FKP+EI  I+K+FDEPG LAPTGL LGGTKYMVIQGE G VIRGKKG  
Sbjct  59   IMRPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSS 118
Query  93   GICVKKTGQALIFGIYDEPVTPGQCNMIVERLGDYLVEQG 132
            GI +KKTGQALIFGIY+EPVTPGQCNM+VE++GDYLV+QG
Sbjct  119  GITIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 75.0 bits 270,  Expect = 8e-16
 Identities = 49/122 40%, Positives = 74/122 60%, Gaps = 10/122 8%
Query  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGV-DGSVWAQ-SANFP-QFKPDEIAAIVKEF- 56
            MSWQ+YVD+++ C  +     L  A I G+ DG+VWA+   ++P Q    E+  I     
Sbjct  1    MSWQSYVDNQI-C--QHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIR 55
Query  57   DEPGTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQ 116
              P ++   G+HLGG KY+ IQ +   ++RG+KG   +C+  T   L+     +   PGQ
Sbjct  56   SNPNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQ 114
Query  117  CNMIVERLGDYL 128
             N +VE+LGDYL
Sbjct  115  LNNVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.