The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL
APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE
RLGDYLVEQGM
Sequence Info Allergen Name Length Opt Bits Score E Value
O24650 Phl p 12.0102 131 903 244.1 9.4e-67
P35079 Phl p 12.0101 131 896 242.2 3.4e-66
CAA54686 Phl p 12.0101 131 896 242.2 3.4e-66
O24282 Phl p 12.0103 131 884 239.1 3e-65
Q9FUD1 Ory s 12.0101 131 825 223.6 1.4e-60
P35083 Zea m 12.0103 131 804 218.0 6.5e-59
P35081 Zea m 12.0101 131 803 217.8 7.8e-59
O04725 Cyn d 12 131 800 217.0 1.3e-58
Q9M7N0 Hev b 8.0201 131 800 217.0 1.3e-58
P35082 Zea m 12.0102 131 792 214.9 5.8e-58
O49894 Mer a 1 133 789 214.1 1e-57
A0A2I4DNN6 Jug r 7.0101 131 784 212.8 2.5e-57
P52184 Hor v 12.0101 131 782 212.2 3.6e-57
O22655 Zea m 12.0104 131 779 211.5 6.2e-57
AAL07320 Lit c 1 131 774 210.1 1.5e-56
FM164277 Tri a 12.0104 131 774 210.1 1.5e-56
Q8L5D8 Pho d 2.0101 131 770 209.1 3.2e-56
AAL92870 Che a 2 131 769 208.8 3.8e-56
Q9M7M8 Hev b 8.0203 131 769 208.8 3.8e-56
O81982 Hel a 2 133 769 208.8 3.9e-56
P49232 Tri a 12.0101 138 769 208.8 4.1e-56
P49233 Tri a 12.0102 141 769 208.8 4.3e-56
Q9STB6 Hev b 8.0102 131 768 208.6 4.6e-56
Q9FR39 Zea m 12.0105 131 767 208.3 5.5e-56
AAL29690 Lyc e 1 131 766 208.0 6.6e-56
Q9AXH4 Cor a 2 131 766 208.0 6.6e-56
CAD37202 Pru p 4.0201 131 765 207.8 8e-56
Q5XWE1 Citr l 2.0101 131 763 207.2 1.1e-55
Q9LEI8 Hev b 8.0204 131 762 207.0 1.4e-55
Q9XF41 Mal d 4 131 760 206.5 2e-55
AAK01235 Cor a 2 131 760 206.5 2e-55
AAL76933 Dau c 4 134 760 206.4 2e-55
CAD10377 Lyc e 1 131 759 206.2 2.4e-55
AAP13533 Cuc m 2 131 759 206.2 2.4e-55
Q93YG7 Sola l 1.0101 131 759 206.2 2.4e-55
Q9XF38 Pyr c 4 131 758 205.9 2.9e-55
O24169 Ole e 2 134 758 205.9 2.9e-55
P49234 Tri a 12.0103 140 757 205.6 3.8e-55
Q9XF37 Api g 4 134 756 205.4 4.2e-55
Q9M7M9 Hev b 8.0202 131 755 205.1 4.9e-55
O65809 Gly m 3 131 754 204.9 5.9e-55
ACP43298 Ama r 2.0101 133 752 204.3 8.7e-55
CAD10376 Cap a 2 131 751 204.1 1e-54
O65810 Gly m 3 131 751 204.1 1e-54
Q9XF40 Mal d 4 131 750 203.8 1.2e-54
O24170 Ole e 2 134 750 203.8 1.3e-54
O65812 Hev b 8.0101 131 749 203.6 1.5e-54
AAK54835 Ana c 1 131 749 203.6 1.5e-54
Q5EF31 Cro s 1.0101 131 746 202.8 2.5e-54
QVU02258 Que ac 2.0101 133 746 202.8 2.6e-54
QID21357 Pop n 2.0101 131 745 202.5 3e-54
A0A023W2L7 Pro j 2.0101 133 745 202.5 3.1e-54
O24171 Ole e 2 134 745 202.5 3.2e-54
ABU95412 Sin a 4.0101 131 743 202.0 4.4e-54
P25816 Bet v 2 133 743 202.0 4.5e-54
Q9XF42 Mal d 4 131 742 201.7 5.3e-54
XP030492464 Can s 2.0101 133 741 201.4 6.5e-54
CAD37201 Pru p 4.0101 131 738 200.7 1.1e-53
AY081852 Pru du 4.0102 131 737 200.4 1.3e-53
AY081850 Pru du 4.0101 131 737 200.4 1.3e-53
Q9SQI9 Ara h 5 131 736 200.1 1.6e-53
Q9XF39 Pru av 4 131 731 198.8 3.9e-53
Q9XG85 Par j 3 132 731 198.8 4e-53
A0A0A0REA1 Koc s 2.0101 133 727 197.8 8.3e-53
A0A0A0RCW1 Aca f 2 133 725 197.2 1.2e-52
Q9T0M8 Par j 3 131 724 197.0 1.4e-52
AF377948 Mus a 1.0101 131 724 197.0 1.4e-52
ACS34771 Sal k 4.0101 133 722 196.5 2.1e-52
AJ421030 Art v 4.0101 133 719 195.7 3.6e-52
QRN65366 Lig v 2.0101 134 719 195.7 3.6e-52
P84177 Cit s 2.0101 131 715 194.6 7.2e-52
Q42449 Ara t 8 131 714 194.4 8.7e-52
AJ421031 Art v 4.0201 133 704 191.7 5.5e-51
ADK22841 Sal k 4.0201 133 692 188.6 4.9e-50
FG438715 Act d 9.0101 109 614 168.2 5.5e-44
QEQ43417 Sola m 1.0101 159 524 144.2 1.3e-36
A0A1B2YLJ4 Tyr p 36.0101 131 253 73.1 2.8e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 244.1 bits 903,  Expect = 9e-67
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYLVEQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 2. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 242.2 bits 896,  Expect = 3e-66
 Identities = 130/131 99%, Positives = 130/131 99%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGMFVAGAKYMVIQGEPG VIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYLVEQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 3. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 242.2 bits 896,  Expect = 3e-66
 Identities = 130/131 99%, Positives = 130/131 99%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGMFVAGAKYMVIQGEPG VIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYLVEQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 4. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 239.1 bits 884,  Expect = 3e-65
 Identities = 128/131 97%, Positives = 130/131 99%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHLASAAI+GHDGTVWAQSADFPQFKPEEITGIMKD+DEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGMFVA AKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYLVEQGM
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 5. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 223.6 bits 825,  Expect = 1e-60
 Identities = 117/131 89%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHL SAAI+GHDGTVWAQSA FPQFKPEE+T IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPGAVIRGKKG+GGIT+KKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 6. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 218.0 bits 804,  Expect = 6e-59
 Identities = 112/131 85%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHL+SAAI+GHDG VWAQS  FPQFKPEE+T I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            AP G+F+   KYMVIQGEPGAVIRGKKG+GGIT+KKTGQALV+GIYDEPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 7. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 217.8 bits 803,  Expect = 8e-59
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHLMCEIEGHHL SAAI+GHDG  WAQS  FP+FKPEE+  IMKDFDEPGHL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPGAVIRGKKG+GGIT+KKTGQ+L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 8. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 217.0 bits 800,  Expect = 1e-58
 Identities = 109/131 83%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEGHHL SAAI+GHDGTVWAQSA FP FKPEE+  IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPGAVIRGKKG+GG+T+KKTGQALV+GIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLVEQGM 131
            +LGDYL+EQGM
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 9. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 217.0 bits 800,  Expect = 1e-58
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHLMC+I+GHHL +AAI+GHDG+VWAQS+ FPQFKPEE+  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPGAVIRGKKG+GGIT+KKTGQAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 10. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 214.9 bits 792,  Expect = 6e-58
 Identities = 110/131 83%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEGHHLA+AAI+GHDG  WAQS  FP+FK E++  IMKDFDEPGHL
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+   KYMVIQGEPGAVIRGKKG+GGIT+KKTGQALVVGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 11. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 214.1 bits 789,  Expect = 1e-57
 Identities = 110/131 83%, Positives = 127/131 96%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQTYVD+HLMC+I+G+  HLA+A+I+GHDG++WAQSA FPQ+KPEEITGIMKDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
            HLAPTG+++AG KYMVIQGE GAVIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 12. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 212.8 bits 784,  Expect = 2e-57
 Identities = 108/131 82%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHLMCEI+G+HL +AAI+GHDG+VWAQS+ FPQFKPEEI  IMKDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGE GAVIRGKKGAGGIT+KKTGQAL+ GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 13. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 212.2 bits 782,  Expect = 4e-57
 Identities = 108/130 83%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HL SAAILGHDG VW QS +FPQFKPEEI GI+KDFDEPGHL
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYLVEQG
Sbjct  121  RLGDYLVEQG 130

Sequence Alignment: 14. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 211.5 bits 779,  Expect = 6e-57
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEG+HL++AAI+GHDG+VWAQS  FP++KPEE+ GI+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+FV G KYMVIQGEPG VIRGKKG GGITIKKTG +L++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 15. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 210.1 bits 774,  Expect = 2e-56
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HLMCE +G+HL +AAI+GHDG+VWAQSA+FPQFKP EI  IMKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPGAVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYLV+QG+
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 16. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 210.1 bits 774,  Expect = 2e-56
 Identities = 105/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSW+ YVD+HL CEI+G+HL SAAILGHDG+VWAQS +FPQFKPEEI GI+KDF+EPGHL
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 17. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 209.1 bits 770,  Expect = 3e-56
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVDEHLMCEI+GHHL +AAILGHDG+VWAQS+ FPQFK EEIT IM DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++   KYMVIQGEPGAVIRGKKG+GG+T+KKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 18. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 208.8 bits 769,  Expect = 4e-56
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HLMC+IEG+HL+SAAILGHDGTVWAQS  FPQ+KPEE++ IMKDF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPG VIRGKKG GG+TIKKT QAL++GIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            R+GDYLVEQGM
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 19. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 208.8 bits 769,  Expect = 4e-56
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HLMC+I+GH L +AAI+GHDG+VWAQS+ FPQFK +E+  +MKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPGAVIRGKKG+GGIT+KKTGQAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 20. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 208.8 bits 769,  Expect = 4e-56
 Identities = 110/131 83%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQ YVDEHLMC+IEG  +HL SAAILG DGTVWAQSA FPQFKPEE+ GI+K+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTGMF+AGAKYMV+QGEPGAVIRGKKGAGGI IKKTGQA+++GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYL+EQGM
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 21. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 208.8 bits 769,  Expect = 4e-56
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HL CEI+G+HL SAAILGHDG+VW +S +FP+FKPEEI GI+KDF+EPGHL
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 22. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 208.8 bits 769,  Expect = 4e-56
 Identities = 104/130 80%, Positives = 120/130 92%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HL CEI+G+HL SAAILGHDG+VWA+S +FP+FKPEEI GI+KDF+EPGHL
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 23. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 208.6 bits 768,  Expect = 5e-56
 Identities = 103/130 79%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+G+DG+VWAQSA+FPQFK EEITGIM DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG GG+T+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 24. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 208.3 bits 767,  Expect = 6e-56
 Identities = 102/130 78%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HL+C+IEG+HL++AAI+GHDG+VWAQS +FP++KPEE+ G++KDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+FV G KYMVIQGEPG VIRGKKG GGITIKKTG +L++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 25. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 208.0 bits 766,  Expect = 7e-56
 Identities = 105/131 80%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HLMC+IEG+HL SAAI+G+DG+VWAQSA+FPQFKPEEIT IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGE GAVIRGKKGAGGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDY++EQG+
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 26. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 208.0 bits 766,  Expect = 7e-56
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ Y DEHLMCEIEG+ LA+AAI+GHDG+VWAQS+ FPQ+KPEEITG+M DF+EPG L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG GG+T+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 27. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 207.8 bits 765,  Expect = 8e-56
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GHDG+VWAQSA FPQ+KPEE+TGI+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG GG+T+KK+  AL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 28. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 207.2 bits 763,  Expect = 1e-55
 Identities = 102/131 77%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEG+HL SAAI+G+DG+VWA+S +FPQ+KPEEITGI+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G+KYMVIQGEPGAVIRGKKG GG+T+KKT  ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 29. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 207.0 bits 762,  Expect = 1e-55
 Identities = 100/131 76%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HLMC+I+GH L +AAI+GHDG+VWAQS+ FPQFK +E+  +MKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGEPGAVIRGKKG+GGIT+KKTGQAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 30. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 206.5 bits 760,  Expect = 2e-55
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMCEIEG+HL++AAI+GH+G+VWAQSA FPQ+KPEE+TGIM DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GG+T+KK+  AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 31. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 206.5 bits 760,  Expect = 2e-55
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTY DEHLMCEIEG+ LA+AAI+GHDG+VWAQS+ FPQ+KPEEITG+M DF+EPG L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIR KKG GG+T+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 32. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 206.4 bits 760,  Expect = 2e-55
 Identities = 103/131 78%, Positives = 126/131 96%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGH---HLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
            MSWQTYVD+HLMCE++G+   +L++AAI+GHDG+VWAQS+ FP+FKPEEITGIMK+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
            GHLAPTG+++ G KYMVIQGEP AVIRGKKG+GG+TIKKTGQALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLVEQGM 131
            +VERLGDYL+EQG+
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 33. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 206.2 bits 759,  Expect = 2e-55
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHL+CE EG+HL SAAI+G+DGTVWAQSA+FPQFKPEEITGIM DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEP AVIRGKKG GGITIKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 34. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 206.2 bits 759,  Expect = 2e-55
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVDEHLMCEIEG+HL SAAI+G+DG+VWAQS +FPQ+KPEE+ GI+ DF +PG L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG GG+T+KKTG ALV+GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 35. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 206.2 bits 759,  Expect = 2e-55
 Identities = 106/131 80%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHL+CE EG+HL SAAI+G+DGTVWAQSA+FPQFKPEEITGIM DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEP AVIRGKKG GGITIKKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 36. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 205.9 bits 758,  Expect = 3e-55
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+GHHL +AAILGHDG+VWAQS+ FP+FKPEEIT IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGE GAVIRGKKG+GG+T+KKT QALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 37. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 205.9 bits 758,  Expect = 3e-55
 Identities = 108/131 82%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    L +AAI+GHDG+VWAQSA FPQFKPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
            GHLAPTG+ + G KYMVIQGE GAVIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGM 131
            VVERLGDYLVEQGM
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 38. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 205.6 bits 757,  Expect = 4e-55
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSW+ YVD+HL CEI+G++L SAAILGHDG+VWAQS +FPQFKPEE  GI+KDF+EPGHL
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGEPG VIRGKKG GGITIKKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 39. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 205.4 bits 756,  Expect = 4e-55
 Identities = 103/131 78%, Positives = 122/131 93%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
            MSWQ YVD+HLMCE+EG+    L +AAI+GHDG+VWAQS+ FPQ KPEEI GIMKDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
            GHLAPTG+++ GAKYMVIQGEP AVIRGKKG+GG+TIKKTGQALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLVEQGM 131
            +VERLGDYL++QG+
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 40. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 205.1 bits 755,  Expect = 5e-55
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HLMC+I+GH L +AAI+GHDG+VWAQS+ FPQFK +E+  IMKDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ +   KYMVIQGEPGAVIRGKKG+GGIT+KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 41. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 204.9 bits 754,  Expect = 6e-55
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HL+C+IEG+HL  AAI+G+DG+VWAQS DFPQFKPEEIT IM DF+EPG L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG GG+T+KKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            R GDYL++QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 42. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 204.3 bits 752,  Expect = 9e-55
 Identities = 106/130 81%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQ YVD+HLMCEIEG  +HL  AAILG DG+VWAQSADFPQFKP+EI  I++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTG+ + G KYMVIQGEPGAVIRGKKGAGGI +KKTGQALV+GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 43. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 204.1 bits 751,  Expect = 1e-54
 Identities = 104/131 79%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HLMCEIEG+ L SAAI+G+DG+VWAQSA FPQFKPEEIT IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGE GAVIRGKKG GGIT+KKT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQ +
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 44. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 204.1 bits 751,  Expect = 1e-54
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HL+C IEG+HL  AAI+G+DG+VW QS DFPQFKPEEIT IM DF+EPG L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG GG+T+KKTG AL++GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 45. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 203.8 bits 750,  Expect = 1e-54
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+ LMC+I+GHHL +AAILGHDG+VWA+S+ FP+FKPEEIT IMKDFDEPG L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGE GAVIRGKKG+GG+T+KKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 46. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 203.8 bits 750,  Expect = 1e-54
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    L +AAI+GHDG+VWAQSA FPQFKPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
            GHLAPTG+ + G KYMVIQGE GAVIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGM 131
            VVERLGDYL+EQG+
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 47. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 203.6 bits 749,  Expect = 1e-54
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDE LMCEIEG+HL +AAI+G+DG+VWAQS++FPQFK EEIT IM DFDEPG L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+ + G KYMVIQGE GAVIRGKKG GG+T++KT QAL++GIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQGM
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 48. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 203.6 bits 749,  Expect = 1e-54
 Identities = 101/130 77%, Positives = 117/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMCEI+G+HL+SAAILGHD TVWAQS +FPQFKPEEI+ I+ DF+ PG L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPG VIRGKKG GGIT+KKT  AL++G+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLLEQG 130

Sequence Alignment: 49. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 202.8 bits 746,  Expect = 3e-54
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVDEHLMC+++GH L SAAILGHDG+VWAQSA FP++KP EIT I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTGM++ GAKYMVIQGEPG VIRGKKG+GG+TIKK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 50. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 202.8 bits 746,  Expect = 3e-54
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQTYVDEHLMC+I+G+  HLA+AAI+GHDG+VWAQS++FPQFK EEI+ IMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
            HLAPTG+ + G KYMVIQGE GAVIRGKKG+GG+TIKKT QALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 51. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 202.5 bits 745,  Expect = 3e-54
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMC+IEG+ L SAAI+GHDG+VWA SA FPQF  EE++ IMKDF+EPG L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGEPGAVIRGKKG+GG+T+KKT QAL++G+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL++QG+
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 52. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 202.5 bits 745,  Expect = 3e-54
 Identities = 104/131 79%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQTYVD+HLMCEIEG  +HL++AAILG DG+VWAQSA FPQFKP+EI+ ++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTG+ + G KYMVIQGEPG VIRGKKG GGI +KKTGQAL++GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 53. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 202.5 bits 745,  Expect = 3e-54
 Identities = 105/131 80%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    L +AAI+GHDG+VWAQSA FPQFKPEE+ GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
            GHLAPTG+ + G KYMVIQGE GAVIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGM 131
            V ERLGDYL+EQG+
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 54. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 202.0 bits 743,  Expect = 4e-54
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HLMC++EG+ L +AAILG+DG+VWAQSA+FPQ+KPEEI GI  DF EPG L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGEP AVIRGKKGAGG+TIKKT QA+V GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 55. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 202.0 bits 743,  Expect = 4e-54
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGHHLAS--AAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQTYVDEHLMC+I+G+   S  +AI+GHDG+VWAQS+ FPQFKP+EITGIMKDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
            HLAPTG+ + G KYMVIQGE GAVIRGKKG+GGITIKKTGQALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 56. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 201.7 bits 742,  Expect = 5e-54
 Identities = 101/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP FKPEEI  I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGEPGAVIRGKKG+GGITIKKT QAL++GIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 57. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 201.4 bits 741,  Expect = 6e-54
 Identities = 102/131 77%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQTYVDEHLMC+I+G+  HL +AAI+GHDG++WAQS+ FPQ+K +EIT I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
            HLAPTG+ ++G KYMVIQGEPGAVIRGKKG+GG+TIKKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYLV+QG+
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 58. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 200.7 bits 738,  Expect = 1e-53
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP FKPEEI  I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGE GAVIRGKKG+GGIT+KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 59. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 200.4 bits 737,  Expect = 1e-53
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP FKPEEI  I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGE GAVIRGKKG+GGIT+KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 60. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 200.4 bits 737,  Expect = 1e-53
 Identities = 99/131 75%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP FKPEEI  I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGE GAVIRGKKG+GGIT+KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 61. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 200.1 bits 736,  Expect = 2e-53
 Identities = 100/131 76%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD HL+CEIEG HL+SAAILG+DG VWAQS+ FPQFKPEEIT IM DF EPG L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGA+I GKKG GG+TI+KT QAL++GIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL++ G+
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 62. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 198.8 bits 731,  Expect = 4e-53
 Identities = 98/131 74%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP FKPEEI  I+KD+D+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGE GAVIRGKKG+GGIT+KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 63. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 198.8 bits 731,  Expect = 4e-53
 Identities = 101/131 77%, Positives = 121/131 92%, Gaps = 1/131 0%
Query  1    MSWQTYVDEHLMCEI-EGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGH 59
            MSWQ YVD+HLMC++ +G+  ASAAI+GHDG+VWAQSA+FPQ+KPEE+TGIM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVV 119
            LAPTG+F+ G KYMVIQGE GAVIRGKKG+GG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLVEQGM 131
            ERLGDYL+EQG+
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 64. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 197.8 bits 727,  Expect = 8e-53
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HL  AAILG DG+VWAQSA+FPQFKP+EI  I+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTG+ + G KYMVIQGE G VIRGKKG GGI +KKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 65. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 197.2 bits 725,  Expect = 1e-52
 Identities = 103/131 78%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            M WQTYVD+HLMCEIEG  +HL+ AAILG DG+VWAQSA FPQFKP+EI  ++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTG+ + G KYMVIQGEPG  IRGKKG GGI +KKTGQALV GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 66. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 197.0 bits 724,  Expect = 1e-52
 Identities = 102/130 78%, Positives = 121/130 93%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCEI-EGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGH 59
            MSWQ YVD+HLMC++ +G+ LASAAI+GHDG+VWAQSA+FPQ+KPEE+TGIM DF+E G 
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVV 119
            LAPTG+F+ G KYMVIQGE GAVI GKKG+GG T+KKTGQA+V+GIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLVEQGM 131
            ERLGDYL+EQGM
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 67. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 197.0 bits 724,  Expect = 1e-52
 Identities = 99/130 76%, Positives = 116/130 89%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HL+C+I+G+ L +AAI+GHDG+VWAQS  FPQ KPEEI  IMKDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+++ G KYMVIQGEPGAVIRGKKG+GG+TIKKT  AL++GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL +QG
Sbjct  121  RLGDYLFDQG 130

Sequence Alignment: 68. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 196.5 bits 722,  Expect = 2e-52
 Identities = 102/131 77%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQTYVD+HLMCEIEG  +HL +AAILG DG+VWAQSA+FPQFKP+EI+ ++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTG+ + G KYMVIQGE G VIRGKKG GGI +KKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYLVEQGM
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 69. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 195.7 bits 719,  Expect = 4e-52
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HL SAAI+G DGTVWA+SA FP+FKP EI  I+K+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
            +LAPTG+F+ GAKYMVIQGE GAVIRGKKGAGGI IKKTGQA+V GIYDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYL++QGM
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 70. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 195.7 bits 719,  Expect = 4e-52
 Identities = 104/131 79%, Positives = 116/131 88%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEP 57
            MSWQ YVD+HLMC+IEGH    L +AAI+GHDG+VWAQSA FPQFKPEEI GIM DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
            G LAPTG+ + G KYMVIQGE GAVIRGKKG+GGITIKKT QALV GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGM 131
            VV RLGD LV+QGM
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 71. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 194.6 bits 715,  Expect = 7e-52
 Identities = 96/131 73%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ YVD+HLMC+I+G+ L +AAILG+DG+VW+QSA FP F+ EEI  I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGE GAVIRGKKG+GGI +KKT QAL++GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGM 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 72. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 194.4 bits 714,  Expect = 9e-52
 Identities = 99/128 77%, Positives = 115/128 89%, Gaps = 0/128 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQ+YVD+HLMC++EG+HL +AAILG+DG+VWAQSA FPQ+KP+EI GI KDF+EPG L
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
            APTG+F+ G KYMVIQGE GAVIRGKKG GG+TIKKT QALV G YDEPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLVE 128
            RLGDYL+E
Sbjct  121  RLGDYLIE 128

Sequence Alignment: 73. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 191.7 bits 704,  Expect = 6e-51
 Identities = 100/131 76%, Positives = 118/131 90%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HL +AAILG DGTVWA+S  FP+FKPEE+ GI+ +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTG+F+ GAKYMV+QGE GAVIRGKKGAGGI IKKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYLV+Q M
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 74. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 188.6 bits 692,  Expect = 5e-50
 Identities = 97/131 74%, Positives = 113/131 86%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIE--GHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPG 58
            MSWQ YVDEHLMC IE  G+HL S+AI+G DG++WAQS++FPQ KP+EI  I K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   HLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMV 118
             LAPTG+F+ G KYMVIQGEPGAVIRGKKG GG+ IKKT QAL+ GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQGM 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 168.2 bits 614,  Expect = 5e-44
 Identities = 84/109 77%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
            MSWQTYVD+HLMCEIEG++L SAAI+G+DG++WAQSA FPQFKPEEIT IM DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEP 109
            APTG+++ G KYMVIQGE GAVIRGKKG GG+T+KKT QAL++GIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 144.2 bits 524,  Expect = 1e-36
 Identities = 107/130 82%, Positives = 121/130 93%, Gaps = 28/130 21%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQ------------------- 41
            MSWQTYVD+HLMC++EGHHLASAAILG DG+VWAQS  FP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGI 92
                     FKPEEIT IMKDFDEPG LAPTG+F+ G KYMVIQGEPGAVIRGKKG+ GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQG 130
            TIKKTGQAL+ GIY+EP+TPGQCNMVVE++GDYLV+QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 73.1 bits 253,  Expect = 3e-15
 Identities = 48/123 39%, Positives = 71/123 57%, Gaps = 6/123 4%
Query  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQ-SADFP-QFKPEEITGIMKDF-DEP 57
            MSWQ+YVD ++ C+     LA  A L +DG VWA+   D+P Q   +E+  I       P
Sbjct  1    MSWQSYVDNQI-CQHVDCRLAVIAGL-QDGAVWAKFEKDLPKQITQQELKTIADAIRSNP 58
Query  58   GHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNM 117
              +   G+ + G KY+ IQ +  +++RG+KG+  + I  T   L+     +   PGQ N 
Sbjct  59   NSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNN 117
Query  118  VVERLGDYL 126
            VVE+LGDYL
Sbjct  118  VVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.