The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL
APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE
RLGDYLVEQGL
Sequence Info Allergen Name Length Opt Bits Score E Value
P35083 Zea m 12.0103 131 898 256.0 2.5e-70
Q9FUD1 Ory s 12.0101 131 875 249.6 2.1e-68
O04725 Cyn d 12 131 844 240.9 8.3e-66
P35082 Zea m 12.0102 131 830 237.0 1.2e-64
P35081 Zea m 12.0101 131 819 234.0 1e-63
O24650 Phl p 12.0102 131 804 229.8 1.9e-62
Q9M7N0 Hev b 8.0201 131 799 228.4 4.9e-62
P35079 Phl p 12.0101 131 797 227.8 7.2e-62
CAA54686 Phl p 12.0101 131 797 227.8 7.2e-62
O24282 Phl p 12.0103 131 796 227.6 8.8e-62
A0A2I4DNN6 Jug r 7.0101 131 781 223.4 1.6e-60
Q8L5D8 Pho d 2.0101 131 780 223.1 1.9e-60
O22655 Zea m 12.0104 131 777 222.3 3.4e-60
Q9M7M8 Hev b 8.0203 131 768 219.8 2e-59
Q9LEI8 Hev b 8.0204 131 767 219.5 2.4e-59
AAL07320 Lit c 1 131 765 218.9 3.5e-59
P52184 Hor v 12.0101 131 763 218.4 5.1e-59
Q9M7M9 Hev b 8.0202 131 763 218.4 5.1e-59
Q9FR39 Zea m 12.0105 131 761 217.8 7.6e-59
CAD37202 Pru p 4.0201 131 759 217.3 1.1e-58
Q9XF38 Pyr c 4 131 757 216.7 1.6e-58
AAL29690 Lyc e 1 131 755 216.1 2.4e-58
Q9AXH4 Cor a 2 131 754 215.9 2.9e-58
FM164277 Tri a 12.0104 131 754 215.9 2.9e-58
AAL92870 Che a 2 131 753 215.6 3.5e-58
AAP13533 Cuc m 2 131 752 215.3 4.3e-58
Q9XF41 Mal d 4 131 750 214.7 6.3e-58
Q9XF40 Mal d 4 131 749 214.5 7.7e-58
AAL76933 Dau c 4 134 749 214.4 8e-58
P49232 Tri a 12.0101 138 749 214.4 8.4e-58
P49233 Tri a 12.0102 141 749 214.4 8.7e-58
CAD10376 Cap a 2 131 748 214.2 9.3e-58
Q9STB6 Hev b 8.0102 131 748 214.2 9.3e-58
Q5XWE1 Citr l 2.0101 131 748 214.2 9.3e-58
AAK01235 Cor a 2 131 748 214.2 9.3e-58
O65809 Gly m 3 131 746 213.6 1.4e-57
QID21357 Pop n 2.0101 131 744 213.1 2e-57
O65810 Gly m 3 131 743 212.8 2.4e-57
O24169 Ole e 2 134 743 212.8 2.5e-57
AAK54835 Ana c 1 131 742 212.5 3e-57
O65812 Hev b 8.0101 131 742 212.5 3e-57
O49894 Mer a 1 133 741 212.2 3.7e-57
O24170 Ole e 2 134 741 212.2 3.7e-57
P49234 Tri a 12.0103 140 741 212.2 4e-57
A0A023W2L7 Pro j 2.0101 133 740 211.9 4.5e-57
CAD10377 Lyc e 1 131 739 211.7 5.3e-57
Q93YG7 Sola l 1.0101 131 739 211.7 5.3e-57
Q9XF42 Mal d 4 131 739 211.7 5.3e-57
CAD37201 Pru p 4.0101 131 737 211.1 7.8e-57
AY081850 Pru du 4.0101 131 736 210.8 9.4e-57
AY081852 Pru du 4.0102 131 736 210.8 9.4e-57
O24171 Ole e 2 134 736 210.8 9.8e-57
XP030492464 Can s 2.0101 133 735 210.6 1.2e-56
AF377948 Mus a 1.0101 131 734 210.3 1.4e-56
ACP43298 Ama r 2.0101 133 734 210.3 1.4e-56
QVU02258 Que ac 2.0101 133 734 210.3 1.4e-56
Q9XF37 Api g 4 134 733 210.0 1.7e-56
Q9SQI9 Ara h 5 131 732 209.7 2e-56
Q9XF39 Pru av 4 131 730 209.2 3e-56
P25816 Bet v 2 133 727 208.3 5.5e-56
Q9XG85 Par j 3 132 722 206.9 1.4e-55
A0A0A0RCW1 Aca f 2 133 720 206.4 2.1e-55
O81982 Hel a 2 133 717 205.5 3.8e-55
A0A0A0REA1 Koc s 2.0101 133 716 205.3 4.6e-55
ABU95412 Sin a 4.0101 131 715 205.0 5.4e-55
P84177 Cit s 2.0101 131 714 204.7 6.6e-55
ACS34771 Sal k 4.0101 133 711 203.9 1.2e-54
Q5EF31 Cro s 1.0101 131 710 203.6 1.4e-54
Q9T0M8 Par j 3 131 709 203.3 1.7e-54
QRN65366 Lig v 2.0101 134 707 202.7 2.6e-54
Q42449 Ara t 8 131 703 201.7 5.5e-54
ADK22841 Sal k 4.0201 133 690 198.0 7e-53
AJ421030 Art v 4.0101 133 689 197.7 8.4e-53
AJ421031 Art v 4.0201 133 683 196.1 2.7e-52
FG438715 Act d 9.0101 109 609 175.7 3.1e-46
QEQ43417 Sola m 1.0101 159 539 155.8 4.3e-40
A0A1B2YLJ4 Tyr p 36.0101 131 247 74.6 9.4e-16
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Zea m 12.0103 Sequence ID: P35083

 Score = 256.0 bits 898,  Expect = 2e-70
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE
Sbjct  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 2. Allergen Name: Ory s 12.0101 Sequence ID: Q9FUD1

 Score = 249.6 bits 875,  Expect = 2e-68
 Identities = 125/131 95%, Positives = 128/131 97%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL+SAAIVGHDG VWAQS AFPQFKPEEMTNI+KDFDEPGFL
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALV+GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 3. Allergen Name: Cyn d 12 Sequence ID: O04725

 Score = 240.9 bits 844,  Expect = 8e-66
 Identities = 116/131 88%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMCEIEGHHL+SAAI+GHDG VWAQS AFP FKPEEM NI+KDFDEPGFL
Sbjct  1    MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLGPTKYMVIQGEPGAVIRGKKGSGG+TVKKTGQALVIGIYDEPMTPGQCNMV+E
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE 120
Query  121  RLGDYLVEQGL 131
            +LGDYL+EQG+
Sbjct  121  KLGDYLIEQGM 131

Sequence Alignment: 4. Allergen Name: Zea m 12.0102 Sequence ID: P35082

 Score = 237.0 bits 830,  Expect = 1e-64
 Identities = 117/131 89%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVDEHLMCEIEGHHL++AAIVGHDGA WAQSTAFP+FK E+M NI+KDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANIMKDFDEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALV+GIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 5. Allergen Name: Zea m 12.0101 Sequence ID: P35081

 Score = 234.0 bits 819,  Expect = 1e-63
 Identities = 116/131 88%, Positives = 124/131 94%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL+SAAIVGHDGA WAQSTAFP+FKPEEM  I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQ+L+IGIYDEPMTPGQCN+VVE
Sbjct  61   APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 6. Allergen Name: Phl p 12.0102 Sequence ID: O24650

 Score = 229.8 bits 804,  Expect = 2e-62
 Identities = 112/131 85%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL+SAAI+GHDG VWAQS  FPQFKPEE+T I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP G+F+   KYMVIQGEPGAVIRGKKG+GGIT+KKTGQALV+GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 7. Allergen Name: Hev b 8.0201 Sequence ID: Q9M7N0

 Score = 228.4 bits 799,  Expect = 5e-62
 Identities = 110/131 83%, Positives = 125/131 95%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHLMC+I+GHHL++AAI+GHDG+VWAQS++FPQFKPEE+  I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 8. Allergen Name: Phl p 12.0101 Sequence ID: P35079

 Score = 227.8 bits 797,  Expect = 7e-62
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL+SAAI+GHDG VWAQS  FPQFKPEE+T I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP G+F+   KYMVIQGEPG VIRGKKG+GGIT+KKTGQALV+GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 9. Allergen Name: Phl p 12.0101 Sequence ID: CAA54686

 Score = 227.8 bits 797,  Expect = 7e-62
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL+SAAI+GHDG VWAQS  FPQFKPEE+T I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP G+F+   KYMVIQGEPG VIRGKKG+GGIT+KKTGQALV+GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 10. Allergen Name: Phl p 12.0103 Sequence ID: O24282

 Score = 227.6 bits 796,  Expect = 9e-62
 Identities = 111/131 84%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHLMCEIEGHHL+SAAI GHDG VWAQS  FPQFKPEE+T I+KD+DEPG L
Sbjct  1    MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGIMKDLDEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP G+F+   KYMVIQGEPGAVIRGKKG+GGIT+KKTGQALV+GIYDEPMTPGQCNMVVE
Sbjct  61   APTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGM 131

Sequence Alignment: 11. Allergen Name: Jug r 7.0101 Sequence ID: A0A2I4DNN6

 Score = 223.4 bits 781,  Expect = 2e-60
 Identities = 109/131 83%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHLMCEI+G+HL++AAI+GHDG+VWAQS++FPQFKPEE+  I+KDFDEPG L
Sbjct  1    MSWQTYVDEHLMCEIDGQHLTAAAIIGHDGSVWAQSSSFPQFKPEEIAAIMKDFDEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGE GAVIRGKKG+GGITVKKTGQAL+ GIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 12. Allergen Name: Pho d 2.0101 Sequence ID: Q8L5D8

 Score = 223.1 bits 780,  Expect = 2e-60
 Identities = 107/131 81%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVDEHLMCEI+GHHL++AAI+GHDG+VWAQS++FPQFK EE+TNI+ DF+EPG L
Sbjct  1    MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL+ GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGM 131

Sequence Alignment: 13. Allergen Name: Zea m 12.0104 Sequence ID: O22655

 Score = 222.3 bits 777,  Expect = 3e-60
 Identities = 107/131 81%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVDEHLMCEIEG+HLS+AAIVGHDG+VWAQS +FP++KPEE+  IIKDFDEPG L
Sbjct  1    MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLF+G TKYMVIQGEPG VIRGKKG+GGIT+KKTG +L+IG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 14. Allergen Name: Hev b 8.0203 Sequence ID: Q9M7M8

 Score = 219.8 bits 768,  Expect = 2e-59
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HLMC+I+GH L++AAI+GHDG+VWAQS+ FPQFK +E+  ++KDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 15. Allergen Name: Hev b 8.0204 Sequence ID: Q9LEI8

 Score = 219.5 bits 767,  Expect = 2e-59
 Identities = 105/131 80%, Positives = 123/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HLMC+I+GH L++AAI+GHDG+VWAQS++FPQFK +E+  ++KDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGEPGAVIRGKKGSGGITVKKTGQAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLLDQGL 131

Sequence Alignment: 16. Allergen Name: Lit c 1 Sequence ID: AAL07320

 Score = 218.9 bits 765,  Expect = 3e-59
 Identities = 108/131 82%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HLMCE +G+HL++AAI+GHDG+VWAQS  FPQFKP E+  I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGEPGAVIRGKKG GGITVKKT QAL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLV+QGL
Sbjct  121  RLGDYLVDQGL 131

Sequence Alignment: 17. Allergen Name: Hor v 12.0101 Sequence ID: P52184

 Score = 218.4 bits 763,  Expect = 5e-59
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HL CEI+G+HL+SAAI+GHDG VW QS  FPQFKPEE+  IIKDFDEPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG  L++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQG+
Sbjct  121  RLGDYLVEQGF 131

Sequence Alignment: 18. Allergen Name: Hev b 8.0202 Sequence ID: Q9M7M9

 Score = 218.4 bits 763,  Expect = 5e-59
 Identities = 105/131 80%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HLMC+I+GH L++AAI+GHDG+VWAQS++FPQFK +E+  I+KDFDEPG L
Sbjct  1    MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGEPGAVIRGKKGSGGITVKKT QAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 19. Allergen Name: Zea m 12.0105 Sequence ID: Q9FR39

 Score = 217.8 bits 761,  Expect = 8e-59
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HL+C+IEG+HLS+AAIVGHDG+VWAQS  FP++KPEE+  +IKDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLF+G TKYMVIQGEPG VIRGKKG+GGIT+KKTG +L+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLIEQGF 131

Sequence Alignment: 20. Allergen Name: Pru p 4.0201 Sequence ID: CAD37202

 Score = 217.3 bits 759,  Expect = 1e-58
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMCEIEG+HLS+AAI+GHDG+VWAQS  FPQ+KPEE+T I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIRGKKG GG+TVKK+  AL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYLVEQGL
Sbjct  121  RLGDYLVEQGL 131

Sequence Alignment: 21. Allergen Name: Pyr c 4 Sequence ID: Q9XF38

 Score = 216.7 bits 757,  Expect = 2e-58
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMC+I+GHHL++AAI+GHDG+VWAQS+ FP+FKPEE+T I+KDFDEPG L
Sbjct  1    MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGE GAVIRGKKGSGG+TVKKT QALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 22. Allergen Name: Lyc e 1 Sequence ID: AAL29690

 Score = 216.1 bits 755,  Expect = 2e-58
 Identities = 106/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HLMC+IEG+HL+SAAI+G+DG+VWAQS  FPQFKPEE+T I+ DF EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGE GAVIRGKKG+GGITVKKT QAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDY++EQGL
Sbjct  121  RLGDYIIEQGL 131

Sequence Alignment: 23. Allergen Name: Cor a 2 Sequence ID: Q9AXH4

 Score = 215.9 bits 754,  Expect = 3e-58
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ Y DEHLMCEIEG+ L++AAI+GHDG+VWAQS+ FPQ+KPEE+T ++ DF+EPG L
Sbjct  1    MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKT QAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 24. Allergen Name: Tri a 12.0104 Sequence ID: FM164277

 Score = 215.9 bits 754,  Expect = 3e-58
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSW+ YVD+HL CEI+G+HL+SAAI+GHDG+VWAQS  FPQFKPEE+  I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGIVKDFEEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 25. Allergen Name: Che a 2 Sequence ID: AAL92870

 Score = 215.6 bits 753,  Expect = 4e-58
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HLMC+IEG+HLSSAAI+GHDG VWAQS +FPQ+KPEE++ I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGEPG VIRGKKG GG+T+KKT QAL+IGIY EPMTPGQCNMVVE
Sbjct  61   APTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            R+GDYLVEQG+
Sbjct  121  RIGDYLVEQGM 131

Sequence Alignment: 26. Allergen Name: Cuc m 2 Sequence ID: AAP13533

 Score = 215.3 bits 752,  Expect = 4e-58
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVDEHLMCEIEG+HL+SAAI+G+DG+VWAQS  FPQ+KPEE+  I+ DF +PG L
Sbjct  1    MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL++G TKYMVIQGEPGAVIRGKKG GG+TVKKTG ALVIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 27. Allergen Name: Mal d 4 Sequence ID: Q9XF41

 Score = 214.7 bits 750,  Expect = 6e-58
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMCEIEG+HLS+AAI+GH+G+VWAQS  FPQ+KPEE+T I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPG VIRGKKG GG+TVKK+  AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 28. Allergen Name: Mal d 4 Sequence ID: Q9XF40

 Score = 214.5 bits 749,  Expect = 8e-58
 Identities = 103/131 78%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+ LMC+I+GHHL++AAI+GHDG+VWA+S+ FP+FKPEE+T I+KDFDEPG L
Sbjct  1    MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGE GAVIRGKKGSGG+TVKKTGQALV GIY+EP+TPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 29. Allergen Name: Dau c 4 Sequence ID: AAL76933

 Score = 214.4 bits 749,  Expect = 8e-58
 Identities = 103/131 78%, Positives = 124/131 94%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGH---HLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEP 57
            MSWQTYVD+HLMCE++G+   +LS+AAI+GHDG+VWAQS+ FP+FKPEE+T I+K+FDEP
Sbjct  1    MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEITGIMKNFDEP 60
Query  58   GFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAP GL+LG TKYMVIQGEP AVIRGKKGSGG+T+KKTGQALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNL 120
Query  118  VVERLGDYLVEQGL 131
            +VERLGDYL+EQGL
Sbjct  121  IVERLGDYLIEQGL 134

Sequence Alignment: 30. Allergen Name: Tri a 12.0101 Sequence ID: P49232

 Score = 214.4 bits 749,  Expect = 8e-58
 Identities = 101/130 77%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HL CEI+G+HL+SAAI+GHDG+VW +S  FP+FKPEE+  I+KDF+EPG L
Sbjct  1    MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 31. Allergen Name: Tri a 12.0102 Sequence ID: P49233

 Score = 214.4 bits 749,  Expect = 9e-58
 Identities = 101/130 77%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HL CEI+G+HL+SAAI+GHDG+VWA+S  FP+FKPEE+  I+KDF+EPG L
Sbjct  1    MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGIVKDFEEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 32. Allergen Name: Cap a 2 Sequence ID: CAD10376

 Score = 214.2 bits 748,  Expect = 9e-58
 Identities = 106/131 80%, Positives = 118/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HLMCEIEG+ L+SAAI+G+DG+VWAQS  FPQFKPEE+T I+ DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGE GAVIRGKKG GGITVKKT QAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 33. Allergen Name: Hev b 8.0102 Sequence ID: Q9STB6

 Score = 214.2 bits 748,  Expect = 9e-58
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMCEIEG+HLS+AAI+G+DG+VWAQS  FPQFK EE+T I+ DF EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL++G TKYMVIQGEPGAVIRGKKG GG+TVKKT QAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 34. Allergen Name: Citr l 2.0101 Sequence ID: Q5XWE1

 Score = 214.2 bits 748,  Expect = 9e-58
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMCEIEG+HL+SAAI+G+DG+VWA+S  FPQ+KPEE+T I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL++G +KYMVIQGEPGAVIRGKKG GG+TVKKT  ALVIGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 35. Allergen Name: Cor a 2 Sequence ID: AAK01235

 Score = 214.2 bits 748,  Expect = 9e-58
 Identities = 103/131 78%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTY DEHLMCEIEG+ L++AAI+GHDG+VWAQS+ FPQ+KPEE+T ++ DF+EPG L
Sbjct  1    MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIR KKG GG+TVKKT QAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 36. Allergen Name: Gly m 3 Sequence ID: O65809

 Score = 213.6 bits 746,  Expect = 1e-57
 Identities = 103/130 79%, Positives = 119/130 91%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HL+C+IEG+HL+ AAI+G+DG+VWAQST FPQFKPEE+T I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            R GDYL++QG
Sbjct  121  RPGDYLIDQG 130

Sequence Alignment: 37. Allergen Name: Pop n 2.0101 Sequence ID: QID21357

 Score = 213.1 bits 744,  Expect = 2e-57
 Identities = 102/131 77%, Positives = 120/131 91%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMC+IEG+ L+SAAI+GHDG+VWA S +FPQF  EE++ I+KDF+EPG L
Sbjct  1    MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGEPGAVIRGKKGSGG+TVKKT QAL+IG+YDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++QGL
Sbjct  121  RLGDYLIDQGL 131

Sequence Alignment: 38. Allergen Name: Gly m 3 Sequence ID: O65810

 Score = 212.8 bits 743,  Expect = 2e-57
 Identities = 103/130 79%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HL+C IEG+HL+ AAI+G+DG+VW QST FPQFKPEE+T I+ DF+EPG L
Sbjct  1    MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIRGKKG GG+TVKKTG AL+IGIYDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 39. Allergen Name: Ole e 2 Sequence ID: O24169

 Score = 212.8 bits 743,  Expect = 3e-57
 Identities = 107/131 81%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEP 57
            MSWQ YVD+HLMC+IEGH    L++AAIVGHDG+VWAQS  FPQFKPEEM  I+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAP GL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGL 131
            VVERLGDYLVEQG+
Sbjct  121  VVERLGDYLVEQGM 134

Sequence Alignment: 40. Allergen Name: Ana c 1 Sequence ID: AAK54835

 Score = 212.5 bits 742,  Expect = 3e-57
 Identities = 103/131 78%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMCEI+G+HLSSAAI+GHD  VWAQS  FPQFKPEE++ I+ DF+ PG L
Sbjct  1    MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAILNDFENPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPG VIRGKKG+GGITVKKT  AL+IG+YDEPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLALIIGVYDEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGF 131

Sequence Alignment: 41. Allergen Name: Hev b 8.0101 Sequence ID: O65812

 Score = 212.5 bits 742,  Expect = 3e-57
 Identities = 104/131 79%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDE LMCEIEG+HL++AAI+G+DG+VWAQS+ FPQFK EE+T I+ DFDEPG L
Sbjct  1    MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL LG TKYMVIQGE GAVIRGKKG GG+TV+KT QAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQG+
Sbjct  121  RLGDYLLEQGM 131

Sequence Alignment: 42. Allergen Name: Mer a 1 Sequence ID: O49894

 Score = 212.2 bits 741,  Expect = 4e-57
 Identities = 103/131 78%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQTYVD+HLMC+I+G+  HL++A+IVGHDG++WAQS +FPQ+KPEE+T I+KDFDEPG
Sbjct  1    MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GL++  TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLIEQGM 133

Sequence Alignment: 43. Allergen Name: Ole e 2 Sequence ID: O24170

 Score = 212.2 bits 741,  Expect = 4e-57
 Identities = 107/131 81%, Positives = 118/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEP 57
            MSWQ YVD+HLMC+IEGH    L++AAIVGHDG+VWAQS  FPQFKPEEM  I+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAP GL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGL 131
            VVERLGDYL+EQGL
Sbjct  121  VVERLGDYLLEQGL 134

Sequence Alignment: 44. Allergen Name: Tri a 12.0103 Sequence ID: P49234

 Score = 212.2 bits 741,  Expect = 4e-57
 Identities = 101/130 77%, Positives = 118/130 90%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSW+ YVD+HL CEI+G++L+SAAI+GHDG+VWAQS  FPQFKPEE   I+KDF+EPG L
Sbjct  1    MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGIVKDFEEPGHL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGEPG VIRGKKG+GGIT+KKTG AL++GIYDEPMTPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL++QG
Sbjct  121  RLGDYLIDQG 130

Sequence Alignment: 45. Allergen Name: Pro j 2.0101 Sequence ID: A0A023W2L7

 Score = 211.9 bits 740,  Expect = 4e-57
 Identities = 105/131 80%, Positives = 120/131 91%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQTYVD+HLMCEIEG  +HLS+AAI+G DG+VWAQS +FPQFKP+E++ ++KDFD PG
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GL LG TKYMVIQGEPG VIRGKKG GGI VKKTGQAL+IGIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLVEQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 46. Allergen Name: Lyc e 1 Sequence ID: CAD10377

 Score = 211.7 bits 739,  Expect = 5e-57
 Identities = 104/131 79%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHL+CE EG+HL+SAAI+G+DG VWAQS  FPQFKPEE+T I+ DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT QAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 47. Allergen Name: Sola l 1.0101 Sequence ID: Q93YG7

 Score = 211.7 bits 739,  Expect = 5e-57
 Identities = 104/131 79%, Positives = 116/131 88%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHL+CE EG+HL+SAAI+G+DG VWAQS  FPQFKPEE+T I+ DF  PG L
Sbjct  1    MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAVPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEP AVIRGKKG GGIT+KKT QAL+IGIYDEPMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQ L
Sbjct  121  RLGDYLIEQSL 131

Sequence Alignment: 48. Allergen Name: Mal d 4 Sequence ID: Q9XF42

 Score = 211.7 bits 739,  Expect = 5e-57
 Identities = 102/131 77%, Positives = 121/131 92%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ L++AAI+G+DG+VW+QS +FP FKPEE+  I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGEPGAVIRGKKGSGGIT+KKT QAL+IGIYDEP+TPGQCN+VVE
Sbjct  61   APTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 49. Allergen Name: Pru p 4.0101 Sequence ID: CAD37201

 Score = 211.1 bits 737,  Expect = 8e-57
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ L++AAI+G+DG+VW+QS  FP FKPEE+  I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 50. Allergen Name: Pru du 4.0101 Sequence ID: AY081850

 Score = 210.8 bits 736,  Expect = 9e-57
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ L++AAI+G+DG+VW+QS  FP FKPEE+  I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 51. Allergen Name: Pru du 4.0102 Sequence ID: AY081852

 Score = 210.8 bits 736,  Expect = 9e-57
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ L++AAI+G+DG+VW+QS  FP FKPEE+  I+KDFD+PG L
Sbjct  1    MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 52. Allergen Name: Ole e 2 Sequence ID: O24171

 Score = 210.8 bits 736,  Expect = 1e-56
 Identities = 106/131 80%, Positives = 117/131 89%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEP 57
            MSWQ YVD+HLMC+IEGH    L++AAIVGHDG+VWAQS  FPQFKPEEM  I+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEP 60
Query  58   GFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAP GL LG TKYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNM
Sbjct  61   GHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGL 131
            V ERLGDYL+EQGL
Sbjct  121  VAERLGDYLLEQGL 134

Sequence Alignment: 53. Allergen Name: Can s 2.0101 Sequence ID: XP030492464

 Score = 210.6 bits 735,  Expect = 1e-56
 Identities = 102/131 77%, Positives = 123/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQTYVDEHLMC+I+G+  HL++AAI+GHDG++WAQS++FPQ+K +E+T+I KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEITDITKDFEEPG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GL L  TKYMVIQGEPGAVIRGKKGSGG+T+KKTGQAL+ GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLV+QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 54. Allergen Name: Mus a 1.0101 Sequence ID: AF377948

 Score = 210.3 bits 734,  Expect = 1e-56
 Identities = 102/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HL+C+I+G+ L++AAIVGHDG+VWAQS AFPQ KPEE+  I+KDFDEPG L
Sbjct  1    MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGAVIRGKKGSGG+T+KKT  AL+IGIY+EPMTPGQCNMVVE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL +QG+
Sbjct  121  RLGDYLFDQGF 131

Sequence Alignment: 55. Allergen Name: Ama r 2.0101 Sequence ID: ACP43298

 Score = 210.3 bits 734,  Expect = 1e-56
 Identities = 104/130 80%, Positives = 118/130 90%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQ YVD+HLMCEIEG  +HL+ AAI+G DG+VWAQS  FPQFKP+E+  I++DFDEPG
Sbjct  1    MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GL LG TKYMVIQGEPGAVIRGKKG+GGI VKKTGQALV+GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQG 130
            VERLGDYL+EQG
Sbjct  121  VERLGDYLIEQG 132

Sequence Alignment: 56. Allergen Name: Que ac 2.0101 Sequence ID: QVU02258

 Score = 210.3 bits 734,  Expect = 1e-56
 Identities = 104/131 79%, Positives = 122/131 93%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGH--HLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQTYVDEHLMC+I+G+  HL++AAI+GHDG+VWAQS+ FPQFK EE+++I+KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQGQHLAAAAIIGHDGSVWAQSSNFPQFKAEEISDIMKDFEEPG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GL LG TKYMVIQGE GAVIRGKKGSGG+T+KKT QALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTSQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLV+QGL
Sbjct  121  VERLGDYLVDQGL 133

Sequence Alignment: 57. Allergen Name: Api g 4 Sequence ID: Q9XF37

 Score = 210.0 bits 733,  Expect = 2e-56
 Identities = 100/131 76%, Positives = 119/131 90%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEP 57
            MSWQ YVD+HLMCE+EG+    L++AAI+GHDG+VWAQS+ FPQ KPEE+  I+KDFDEP
Sbjct  1    MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEIAGIMKDFDEP 60
Query  58   GFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAP GL+LG  KYMVIQGEP AVIRGKKGSGG+T+KKTGQALV G+YDEP+TPGQCN+
Sbjct  61   GHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKTGQALVFGVYDEPVTPGQCNV 120
Query  118  VVERLGDYLVEQGL 131
            +VERLGDYL++QGL
Sbjct  121  IVERLGDYLIDQGL 134

Sequence Alignment: 58. Allergen Name: Ara h 5 Sequence ID: Q9SQI9

 Score = 209.7 bits 732,  Expect = 2e-56
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD HL+CEIEG HLSSAAI+G+DG VWAQS+ FPQFKPEE+T I+ DF EPG L
Sbjct  1    MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAIMNDFAEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GL+LG TKYMVIQGEPGA+I GKKG GG+T++KT QAL+IGIYD+PMTPGQCNM+VE
Sbjct  61   APTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQALIIGIYDKPMTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL++ GL
Sbjct  121  RLGDYLIDTGL 131

Sequence Alignment: 59. Allergen Name: Pru av 4 Sequence ID: Q9XF39

 Score = 209.2 bits 730,  Expect = 3e-56
 Identities = 101/131 77%, Positives = 119/131 90%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ L++AAI+G+DG+VW+QS  FP FKPEE+  I+KD+D+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGE GAVIRGKKGSGGITVKKT QAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 60. Allergen Name: Bet v 2 Sequence ID: P25816

 Score = 208.3 bits 727,  Expect = 5e-56
 Identities = 104/131 79%, Positives = 121/131 92%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEGHHLSS--AAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQTYVDEHLMC+I+G+  +S  +AIVGHDG+VWAQS++FPQFKP+E+T I+KDF+EPG
Sbjct  1    MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GL LG  KYMVIQGE GAVIRGKKGSGGIT+KKTGQALV GIY+EP+TPGQCNMV
Sbjct  61   HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYL++QGL
Sbjct  121  VERLGDYLIDQGL 133

Sequence Alignment: 61. Allergen Name: Par j 3 Sequence ID: Q9XG85

 Score = 206.9 bits 722,  Expect = 1e-55
 Identities = 103/131 78%, Positives = 119/131 90%, Gaps = 1/131 0%
Query  1    MSWQTYVDEHLMCEI-EGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGF 59
            MSWQ YVD+HLMC++ +G+  +SAAI+GHDG+VWAQS  FPQ+KPEE+T I+ DF+E GF
Sbjct  1    MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEAGF 60
Query  60   LAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVV 119
            LAP GLFLG TKYMVIQGE GAVIRGKKGSGG T+KKTGQA+VIGIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 120
Query  120  ERLGDYLVEQGL 131
            ERLGDYL+EQGL
Sbjct  121  ERLGDYLLEQGL 132

Sequence Alignment: 62. Allergen Name: Aca f 2 Sequence ID: A0A0A0RCW1

 Score = 206.4 bits 720,  Expect = 2e-55
 Identities = 103/131 78%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            M WQTYVD+HLMCEIEG  +HLS AAI+G DG+VWAQS +FPQFKP+E+  ++KDFD PG
Sbjct  1    MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GL LG TKYMVIQGEPG  IRGKKG GGI VKKTGQALV GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLVEQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 63. Allergen Name: Hel a 2 Sequence ID: O81982

 Score = 205.5 bits 717,  Expect = 4e-55
 Identities = 100/131 76%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQ YVDEHLMC+IEG  +HL+SAAI+G DG VWAQS  FPQFKPEEM  IIK+FDE G
Sbjct  1    MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMKGIIKEFDEAG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP G+F+   KYMV+QGEPGAVIRGKKG+GGI +KKTGQA+++GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTGQAMIMGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYL+EQG+
Sbjct  121  VERLGDYLLEQGM 133

Sequence Alignment: 64. Allergen Name: Koc s 2.0101 Sequence ID: A0A0A0REA1

 Score = 205.3 bits 716,  Expect = 5e-55
 Identities = 102/131 77%, Positives = 116/131 88%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HL+ AAI+G DG+VWAQS  FPQFKP+E+  I+K+FDEPG
Sbjct  1    MSWQTYVDDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GL LG TKYMVIQGE G VIRGKKG GGI VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLVEQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 65. Allergen Name: Sin a 4.0101 Sequence ID: ABU95412

 Score = 205.0 bits 715,  Expect = 5e-55
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HLMC++EG+ L++AAI+G+DG+VWAQS  FPQ+KPEE+  I  DF EPG L
Sbjct  1    MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLF+G TKYMVIQGEP AVIRGKKG+GG+T+KKT QA+V GIY+EPMTPGQCNMVVE
Sbjct  61   APTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 66. Allergen Name: Cit s 2.0101 Sequence ID: P84177

 Score = 204.7 bits 714,  Expect = 7e-55
 Identities = 99/131 75%, Positives = 117/131 89%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ YVD+HLMC+I+G+ L++AAI+G+DG+VW+QS  FP F+ EE+  I+KDFD+PG L
Sbjct  1    MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG TKYMVIQGE GAVIRGKKGSGGI VKKT QAL+IGIYDEP+TPGQCNM+VE
Sbjct  61   APTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+EQGL
Sbjct  121  RLGDYLIEQGL 131

Sequence Alignment: 67. Allergen Name: Sal k 4.0101 Sequence ID: ACS34771

 Score = 203.9 bits 711,  Expect = 1e-54
 Identities = 101/131 77%, Positives = 117/131 89%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQTYVD+HLMCEIEG  +HL++AAI+G DG+VWAQS  FPQFKP+E++ ++K+FDE G
Sbjct  1    MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GL LG TKYMVIQGE G VIRGKKG GGI VKKTGQAL+ GIYDEP+TPGQCNM+
Sbjct  61   TLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMI 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLVEQG+
Sbjct  121  VERLGDYLVEQGM 133

Sequence Alignment: 68. Allergen Name: Cro s 1.0101 Sequence ID: Q5EF31

 Score = 203.6 bits 710,  Expect = 1e-54
 Identities = 94/130 72%, Positives = 115/130 88%, Gaps = 0/130 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVDEHLMC+++GH L+SAAI+GHDG+VWAQS  FP++KP E+T I+ DF+EPG L
Sbjct  1    MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP G+++   KYMVIQGEPG VIRGKKGSGG+T+KK+  AL+ G+YDEPMTPGQCN+VVE
Sbjct  61   APTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVE 120
Query  121  RLGDYLVEQG 130
            RLGDYL+EQG
Sbjct  121  RLGDYLIEQG 130

Sequence Alignment: 69. Allergen Name: Par j 3 Sequence ID: Q9T0M8

 Score = 203.3 bits 709,  Expect = 2e-54
 Identities = 102/130 78%, Positives = 119/130 91%, Gaps = 2/130 1%
Query  1    MSWQTYVDEHLMCEI-EGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGF 59
            MSWQ YVD+HLMC++ +G+ L+SAAI+GHDG+VWAQS  FPQ+KPEE+T I+ DF+E GF
Sbjct  1    MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTGIMNDFNEGGF 60
Query  60   LAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVV 119
            LAP GLFLG TKYMVIQGE GAVI GKKGSGG T+KKTGQA+VIGIYDEPMTPGQCN+VV
Sbjct  61   LAPTGLFLGGTKYMVIQGESGAVI-GKKGSGGATLKKTGQAIVIGIYDEPMTPGQCNLVV 119
Query  120  ERLGDYLVEQGL 131
            ERLGDYL+EQG+
Sbjct  120  ERLGDYLLEQGM 131

Sequence Alignment: 70. Allergen Name: Lig v 2.0101 Sequence ID: QRN65366

 Score = 202.7 bits 707,  Expect = 3e-54
 Identities = 102/131 77%, Positives = 115/131 87%, Gaps = 3/131 2%
Query  1    MSWQTYVDEHLMCEIEGHH---LSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEP 57
            MSWQ YVD+HLMC+IEGH    L++AAIVGHDG+VWAQS  FPQFKPEE+  I+ DF+EP
Sbjct  1    MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGIMTDFNEP 60
Query  58   GFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNM 117
            G LAP GL LG TKYMVIQGE GAVIRGKKGSGGIT+KKT QALV GIY+EP+TPGQCNM
Sbjct  61   GTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTNQALVFGIYEEPVTPGQCNM 120
Query  118  VVERLGDYLVEQGL 131
            VV RLGD LV+QG+
Sbjct  121  VVWRLGDRLVQQGM 134

Sequence Alignment: 71. Allergen Name: Ara t 8 Sequence ID: Q42449

 Score = 201.7 bits 703,  Expect = 6e-54
 Identities = 97/131 74%, Positives = 115/131 87%, Gaps = 0/131 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQ+YVD+HLMC++EG+HL++AAI+G+DG+VWAQS  FPQ+KP+E+  I KDF+EPGFL
Sbjct  1    MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE 120
            AP GLFLG  KYMVIQGE GAVIRGKKG GG+T+KKT QALV G YDEPMT GQCN+VVE
Sbjct  61   APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE 120
Query  121  RLGDYLVEQGL 131
            RLGDYL+E  L
Sbjct  121  RLGDYLIESEL 131

Sequence Alignment: 72. Allergen Name: Sal k 4.0201 Sequence ID: ADK22841

 Score = 198.0 bits 690,  Expect = 7e-53
 Identities = 98/131 74%, Positives = 112/131 85%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIE--GHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQ YVDEHLMC IE  G+HL+S+AIVG DG++WAQS+ FPQ KP+E+  I K+FD P 
Sbjct  1    MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPN 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GLFLG  KYMVIQGEPGAVIRGKKG GG+ +KKT QAL+ GIYDEP+ PGQCNMV
Sbjct  61   TLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYL+EQGL
Sbjct  121  VERLGDYLIEQGL 133

Sequence Alignment: 73. Allergen Name: Art v 4.0101 Sequence ID: AJ421030

 Score = 197.7 bits 689,  Expect = 8e-53
 Identities = 98/131 74%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HL+SAAI G DG VWA+S +FP+FKP E+  IIK+F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GLFLG  KYMVIQGE GAVIRGKKG+GGI +KKTGQA+V GIYDEP+ PGQCNMV
Sbjct  61   QLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMV 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYL++QG+
Sbjct  121  VERLGDYLLDQGM 133

Sequence Alignment: 74. Allergen Name: Art v 4.0201 Sequence ID: AJ421031

 Score = 196.1 bits 683,  Expect = 3e-52
 Identities = 96/131 73%, Positives = 115/131 87%, Gaps = 2/131 1%
Query  1    MSWQTYVDEHLMCEIEG--HHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPG 58
            MSWQTYVD+HLMC+IEG  +HL++AAI+G DG VWA+S  FP+FKPEEM  II +F+E G
Sbjct  1    MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMKGIINEFNEVG 60
Query  59   FLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMV 118
             LAP GLFLG  KYMV+QGE GAVIRGKKG+GGI +KKTGQA+V+GIYDEP+ PGQCNM+
Sbjct  61   TLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTGQAMVMGIYDEPVAPGQCNMI 120
Query  119  VERLGDYLVEQGL 131
            VERLGDYLV+Q +
Sbjct  121  VERLGDYLVDQNM 133

Sequence Alignment: 75. Allergen Name: Act d 9.0101 Sequence ID: FG438715

 Score = 175.7 bits 609,  Expect = 3e-46
 Identities = 85/109 77%, Positives = 99/109 90%, Gaps = 0/109 0%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL 60
            MSWQTYVD+HLMCEIEG++L+SAAI+G+DG++WAQS +FPQFKPEE+T I+ DF EPG L
Sbjct  1    MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL 60
Query  61   APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEP 109
            AP GL+LG TKYMVIQGE GAVIRGKKG GG+TVKKT QAL+IGIYDEP
Sbjct  61   APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP 109

Sequence Alignment: 76. Allergen Name: Sola m 1.0101 Sequence ID: QEQ43417

 Score = 155.8 bits 539,  Expect = 4e-40
 Identities = 108/130 83%, Positives = 124/130 95%, Gaps = 28/130 21%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQ------------------- 41
            MSWQTYVD+HLMC++EGHHL+SAAI+G DG+VWAQS AFP+                   
Sbjct  1    MSWQTYVDDHLMCDLEGHHLASAAILGFDGSVWAQSPAFPKEQHTMCDRCSRSGVNCYIM 60
Query  42   ---------FKPEEMTNIIKDFDEPGFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGI 92
                     FKPEE+TNI+KDFDEPGFLAP GLFLG TKYMVIQGEPGAVIRGKKGS GI
Sbjct  61   RPLYLYQAKFKPEEITNIMKDFDEPGFLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSSGI 120
Query  93   TVKKTGQALVIGIYDEPMTPGQCNMVVERLGDYLVEQG 130
            T+KKTGQAL+ GIY+EP+TPGQCNMVVE++GDYLV+QG
Sbjct  121  TIKKTGQALIFGIYEEPVTPGQCNMVVEKIGDYLVDQG 158

Sequence Alignment: 77. Allergen Name: Tyr p 36.0101 Sequence ID: A0A1B2YLJ4

 Score = 74.6 bits 247,  Expect = 9e-16
 Identities = 49/122 40%, Positives = 71/122 58%, Gaps = 8/122 6%
Query  1    MSWQTYVDEHLMCEIEGHHLSSAAIVG-HDGAVWAQ-STAFP-QFKPEEMTNIIKDF-DE 56
            MSWQ+YVD ++ C+     L  A I G +DGAVWA+    +P Q   +E+  I       
Sbjct  1    MSWQSYVDNQI-CQHVDCRL--AVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSN 57
Query  57   PGFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCN 116
            P  +   G+ LG  KY+ IQ +  +++RG+KGS  + +  T   L+     +   PGQ N
Sbjct  58   PNSFLEGGIHLGGEKYICIQAD-NSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLN 116
Query  117  MVVERLGDYL 126
             VVE+LGDYL
Sbjct  117  NVVEKLGDYL 126

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.