The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDE
RQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQ
RTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVN
HLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQ
SEEEERGLIVMARERMTFVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADI
FSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQV
VDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIR
AMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9XHP0 Ses i 6.0101 459 3044 700.2 5.8e-203
DQ631677 Pis v 2.0201 472 1241 289.2 3.2e-79
Q9AUD2 Ses i 7.0101 497 1221 284.6 7.9e-78
AAO38859 Ber e 2 465 980 229.7 2.5e-61
P13744 Cuc ma 4.0101 480 912 214.2 1.2e-56
QYU76044 Zan b 2.02 383 869 204.4 8.3e-54
AAN76862 Ana o 2 457 851 200.3 1.8e-52
Q2TLW0 Sin a 2.0101 510 843 198.4 7.1e-52
DQ631676 Pis v 2.0101 496 741 175.2 6.8e-45
QYU76045 Zan b 2.0101 389 720 170.5 1.4e-43
QYU76046 Zan b 2.0102 388 717 169.8 2.3e-43
QYS16039 Zan b 2.03 389 687 162.9 2.6e-41
Q9XFM4 Fag e 1 538 688 163.1 3.2e-41
BAA21758 Fag e 1 565 663 157.4 1.8e-39
Q2TPW5 Jug r 4.0101 507 640 152.2 6e-38
A0A1L6K371 Jug n 4.0101 510 640 152.2 6e-38
ABW86978 Car i 4.0101 505 638 151.7 8.1e-38
AAL73404 Cor a 9 515 616 146.7 2.7e-36
P09800 Gos h 4 516 613 146.0 4.3e-36
3EHK_A Pru du 6 531 613 146.0 4.5e-36
BAA21760 Fag e 1 504 611 145.5 5.8e-36
ADN39440 Pru du 6.0101 551 610 145.3 7.5e-36
P09802 Gos h 3 509 595 141.9 7.3e-35
ADN39441 Pru du 6.0201 504 588 140.3 2.2e-34
EU410073 Pis v 5.0101 473 584 139.4 3.8e-34
O82580 Ara h 3 507 456 110.2 2.5e-25
AAC63045 Ara h 3 510 456 110.2 2.5e-25
Q7GC77 Gly m 6.0501 517 454 109.8 3.5e-25
P11828 Gly m 6.0301 481 445 107.7 1.3e-24
Q9SB11 Gly m 6.0401 563 445 107.7 1.6e-24
AAA33966 Gly m glycinin G1 495 441 106.8 2.6e-24
P04776 Gly m 6.0101 495 441 106.8 2.6e-24
AAD47382 Ara h 4 530 438 106.1 4.6e-24
P04405 Gly m 6.0201 485 434 105.2 7.7e-24
CAA68460 Gly m glycinin G2 485 434 105.2 7.7e-24
A0A0S3B0K0 Coc n 1.0101 490 191 49.8 3.7e-07
AAF18269 Jug r 2 593 177 46.6 4.2e-06
B3STU4 Car i 2.0101 792 167 44.3 2.8e-05
AAM54366 Jug n 2 481 160 42.8 4.8e-05
BAB21619 Gly m Bd28K 473 158 42.3 6.5e-05
P43238 Ara h 1 626 148 40.0 0.00044
P43237 Ara h 1 614 143 38.8 0.00094
CAD87730 Len c 1.0101 418 134 36.9 0.0025
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ses i 6.0101 Sequence ID: Q9XHP0

 Score = 700.2 bits 3044,  Expect = 6e-203
 Identities = 459/459 100%, Positives = 459/459 100%, Gaps = 0/459 0%
Query  1    MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDE 60
            MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDE
Sbjct  1    MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDE 60
Query  61   RQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQ 120
            RQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQ
Sbjct  61   RQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQ 120
Query  121  RTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVN 180
            RTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVN
Sbjct  121  RTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVN 180
Query  181  HLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQ 240
            HLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQ
Sbjct  181  HLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQ 240
Query  241  SEEEERGLIVMARERMTFVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADI 300
            SEEEERGLIVMARERMTFVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADI
Sbjct  241  SEEEERGLIVMARERMTFVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADI 300
Query  301  FSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQV 360
            FSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQV
Sbjct  301  FSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQV 360
Query  361  VDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIR 420
            VDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIR
Sbjct  361  VDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIR 420
Query  421  AMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS 459
            AMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS
Sbjct  421  AMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS 459

Sequence Alignment: 2. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 289.2 bits 1241,  Expect = 3e-79
 Identities = 186/445 41%, Positives = 295/445 66%, Gaps = 22/445 4%
Query  2    VAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDER 61
            + F +L+  S++ +     +Q R+ +     QC+ Q ++  +P  RI+SE G TE+WD+ 
Sbjct  11   LGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGVTEFWDQN 70
Query  62   QEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVH-RSQ 120
            +EQ+QCA +   R TI+  GL +P+Y+ +P LVY+ +G G+   + PGC ET+Q   +SQ
Sbjct  71   EEQLQCANVAVFRHTIQSRGLLVPSYNNAPELVYVVQGSGIHGAVFPGCPETFQEESQSQ 130
Query  121  RTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVN 180
               + + +   Q  G   + HQKV  +R+GDI+A+P+G AHW YN+G   LV V++ DV 
Sbjct  131  SRSQHSRSERSQQSG---EQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVG 187
Query  181  HLSNQLDQKFRAFYLAGGVPRS-----GEQEQQAR-----QTFHNIFRAFDAELLSEAFN 230
            +  NQLDQ +R F L GG P+      G+   Q+R     Q  +NI+ AFD E+L+++FN
Sbjct  188  NSENQLDQYLRKFVL-GGSPQQEIQGGGQSWSQSRSSRKGQQSNNILSAFDEEILAQSFN 246
Query  231  VPQETIRRMQSEEEERGLIVMARERMTFVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRT 290
            +  + ++++Q EE++RG+IV  +E +  + P  +E E        DNGLEETFCTM ++ 
Sbjct  247  IDTQLVKKLQREEKQRGIIVRVKEDLQVLSPQRQEKEYS------DNGLEETFCTMTLKL 300
Query  291  NVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVY 350
            N+     AD+++ + GRV  ++   LPIL+++ LS EKG LY NA+++P W+M  H+IVY
Sbjct  301  NINDPSRADVYNPRGGRVTSINALNLPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVY 360
Query  351  VTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRS 410
            +TRG+ ++Q+V  NG+++ ++ + +G++ VVPQ +    RA ++GFEWV+FKT G    S
Sbjct  361  ITRGNGRMQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKIS 420
Query  411  PLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGR 457
             LAG  SV+R +PL VI NS+ IS   A  LK +R S+  +++PG R
Sbjct  421  QLAGRISVMRGLPLDVIQNSFDISREDAWNLKESR-SEMTIFAPGSR 466

Sequence Alignment: 3. Allergen Name: Ses i 7.0101 Sequence ID: Q9AUD2

 Score = 284.6 bits 1221,  Expect = 8e-78
 Identities = 188/423 44%, Positives = 286/423 67%, Gaps = 23/423 5%
Query  24   REPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLS 83
            ++ +L     CR +R++  +P++R +SE G TE+WD   +QF+CAG+ A+R+ I+P GL 
Sbjct  39   QQHKLQARTDCRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLL 98
Query  84   LPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRGSVRDLHQK 143
            LP+Y+ +P+L+Y+ RG+G+   ++PGCAET+         ER     Q  R    D HQK
Sbjct  99   LPHYNNAPQLLYVVRGRGIQGTVIPGCAETF---------ERDTQPRQDRRRRFMDRHQK 149
Query  144  VHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGVPRSG 203
            V ++RQGDI+A+P+G   W YN+G E L+ V++ D  + +NQLDQ FR F+LAG  P+ G
Sbjct  150  VRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFFLAGN-PQGG 208
Query  204  EQ--------EQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARER 255
             Q        E+Q  +T  NIF  FD E+L++AF V  +T RR++ +++ RG IV A ER
Sbjct  209  RQSYFGRPQTEKQQGET-KNIFNGFDDEILADAFGVDVQTARRLKGQDDLRGRIVRA-ER 266
Query  256  MTFVRPDEEEGEQEHRG-RQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRN 314
            +  V P EEE E+  R      NGLEET+CT K+R N++    AD+++ + GR+  ++  
Sbjct  267  LDIVLPGEEEEERWERDPYSGANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSL 326
Query  315  KLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVN 374
             LP+L ++ LSAEKG LY N LV+P W++  H+I+Y+TRG  + QVV H G+++ +  V 
Sbjct  327  TLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVR 386
Query  375  QGEMFVVPQYYTSTARAGNN-GFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQI 433
            +G++ +VPQ Y    RA  + G+EW++FKT  + M S LAG  S IRAMP +V+  +YQ+
Sbjct  387  EGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQV 446
Query  434  SPNQAQALKMNRGSQSFLLSPGGRRS 459
            S ++A+ LK NR  +S ++S   R S
Sbjct  447  SRDEARRLKYNR-EESRVFSSTSRYS 471

Sequence Alignment: 4. Allergen Name: Ber e 2 Sequence ID: AAO38859

 Score = 229.7 bits 980,  Expect = 3e-61
 Identities = 189/441 42%, Positives = 298/441 67%, Gaps = 24/441 5%
Query  6    FLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQF 65
            FLL+L + LL    +A   E    +  +CR QR++  +P  R+++E G +E+WD   +QF
Sbjct  5    FLLSLGIFLLFHCCLAIEYEQE--ELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQF 62
Query  66   QCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMER 125
            +CAG+ A+R+TIRP GL LP Y  +P+L Y+ +G+G++ +++PGC ET+Q      +M +
Sbjct  63   RCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQ------SMSQ 116
Query  126  TEASEQQD--RGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLS 183
             + S +Q+  RG  +D HQKVH L++GDI+AIP+G A WCYNDG EDLV V +       
Sbjct  117  FQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDL 176
Query  184  NQLDQKFRAFYLAGGVPRSGEQEQQ------ARQTF-HNIFRAFDAELLSEA--FNVPQE 234
            NQLDQ  R F+LAG + RS +Q  +       +Q +  N+F+ F+ E L++   F +  E
Sbjct  177  NQLDQNPRHFFLAGNIQRSQKQRGERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTE 236
Query  235  TIRRMQSEEEERGLIVMARERMTFVRPDE--EEGEQEHRGRQLDNGLEETFCTMKFRTNV 292
            T R+++ E+++RG IV   + +  +RP    EE EQ+  G    NGLEET C+  F  N+
Sbjct  237  TARKVRGEDDQRGHIVRVEQGLKVIRPPRIREELEQQEGGGY--NGLEETICSATFIQNI 294
Query  293  ESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVT 352
            ++  EAD ++ +AGR+  V+  K+PIL ++ LSA KG LY NA+++P W +  +++VY  
Sbjct  295  DNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLWRLNANSVVYAV 354
Query  353  RGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPL 412
            RG+A+VQ+VDH G+ + +D + +G+M VVPQ +    +AG+ GFEWV F T  + + S  
Sbjct  355  RGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQAGSRGFEWVVFNTNDNALFSTA 414
Query  413  AGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGR 457
            AG TS +R +P+ V+ N+Y++S  +A+ +K+NR  ++ L+ PG R
Sbjct  415  AGRTSPLRGIPVGVLANAYRLSQEEARRIKLNR-DEAVLFQPGSR 458

Sequence Alignment: 5. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 214.2 bits 912,  Expect = 1e-56
 Identities = 177/422 41%, Positives = 282/422 66%, Gaps = 33/422 7%
Query  24   REPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLS 83
            ++ R    + CR++ +    P  R ++E   TE+WD+  ++FQCAG+  +R TIRP GL 
Sbjct  38   QQHRYQSPRACRLENLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLL 97
Query  84   LPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRGSV-RDLHQ 142
            LP +  +P+L+++ +G G+  I +PGCAETYQ          T+    Q  GS  +D HQ
Sbjct  98   LPGFSNAPKLIFVAQGFGIRGIAIPGCAETYQ----------TDLRRSQSAGSAFKDQHQ 147
Query  143  KVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAG---GV 199
            K+  +R+GD++ +P+G +HW YN G  DLV +   D  +++NQ+D  +R FYLAG    V
Sbjct  148  KIRPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRNVANQIDPYLRKFYLAGRPEQV 207
Query  200  PRSGEQ-EQQARQTFH-----NIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMAR 253
             R  E+ E+ +R+        NIF  F  E+L EAF +    +R+++ E++ER  IV   
Sbjct  208  ERGVEEWERSSRKGSSGEKSGNIFSGFADEFLEEAFQIDGGLVRKLKGEDDERDRIVQVD 267
Query  254  ERMTFVRPDEEEGEQEHRGRQLD------NGLEETFCTMKFRTNVESRREADIFSRQAGR 307
            E    + P+++E E+  RGR ++      NGLEET CT++++ N+     AD+F+ + GR
Sbjct  268  EDFEVLLPEKDE-EERSRGRYIESESESENGLEETICTLRLKQNIGRSVRADVFNPRGGR 326
Query  308  VHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQA 367
            +   + + LPIL+ + LSAE+G LYSNA+V+P +++  H+++Y TRG+A+VQVVD+ GQ+
Sbjct  327  ISTANYHTLPILRQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQS 386
Query  368  LMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVI 427
            + +  V +G+++++PQ +    RA + GFEW+AFKT  + + + LAG  S +R +PL V+
Sbjct  387  VFDGEVREGQVLMIPQNFVVIKRASDRGFEWIAFKTNDNAITNLLAGRVSQMRMLPLGVL 446
Query  428  TNSYQISPNQAQALKMNRGSQSF-LLSPG---GRR 458
            +N Y+IS  +AQ LK   G Q   +LSPG   GRR
Sbjct  447  SNMYRISREEAQRLKY--GQQEMRVLSPGRSQGRR 479

Sequence Alignment: 6. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 204.4 bits 869,  Expect = 8e-54
 Identities = 169/367 46%, Positives = 248/367 67%, Gaps = 25/367 6%
Query  51   EGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGC 110
            E G TE+WD+   Q+QCA +   R  I+ NGL +P Y  +  L Y+ +G+G+   + PGC
Sbjct  1    EAGVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGC 60
Query  111  AETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSED 170
             ETYQ ++ Q++ + ++ S  QD+      HQKV ++R+GDI+A+P+GAAHW YN+G   
Sbjct  61   PETYQDQQQQQSYQ-SQGSRSQDQ------HQKVRQIREGDIIALPTGAAHWIYNNGGSQ 113
Query  171  LVAVSINDVNHLSNQLDQKFRAFYLAGGVPR---SGEQEQQARQTFH------------N 215
            LV V++ DV +  NQLDQ FR FYL GG P+    G  ++Q    ++            N
Sbjct  114  LVLVALVDVGNSDNQLDQYFRKFYL-GGNPQPELQGTSQRQQGGGYQGSQGGGGGSRRGN 172
Query  216  IFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVRPDE-EEGEQEHRGRQ 274
            +F  FD  LL++AFNV  E IRR+Q  + +RG+IV   E    + P   +E EQE+  + 
Sbjct  173  MFNGFDERLLADAFNVNPELIRRLQRPQMQRGIIVRVEEEFRVLSPQRGQEQEQEQE-QD 231
Query  275  LDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSN 334
             DNG+EETFCTMK+R N+     AD+++ + GRV  V+R  LP+L+++ LSAEKGNLY N
Sbjct  232  CDNGVEETFCTMKLRHNINDPSRADVYNPRGGRVTTVNRFNLPVLRWLQLSAEKGNLYQN 291
Query  335  ALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNN 394
            AL SP W++  H+IVY+TRG  ++Q+V  NG  + N  + +G++ V+PQ +    +A N 
Sbjct  292  ALTSPHWNLNCHSIVYITRGSGRMQIVSENGNDVFNGEIREGQLIVIPQGFAVVKKASNR 351
Query  395  GFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQV 426
            G+EW+AFKT  + M + LAG  SV+RA+PL V
Sbjct  352  GLEWIAFKTNDNAMTNQLAGRVSVMRALPLDV 383

Sequence Alignment: 7. Allergen Name: Ana o 2 Sequence ID: AAN76862

 Score = 200.3 bits 851,  Expect = 2e-52
 Identities = 190/435 43%, Positives = 284/435 65%, Gaps = 25/435 5%
Query  8    LALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQC 67
            L++ + +L    +A  +E    Q  +C+  R+   +P  R++ E GT E WD  +EQF+C
Sbjct  1    LSVCFLILFHGCLASRQE--WQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRC 58
Query  68   AGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTE 127
            AG+  +R TI+PNGL LP Y  +P+L+Y+ +G+G+  I  PGC ETYQ  +  R      
Sbjct  59   AGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGR------ 112
Query  128  ASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLD 187
              +Q   G  +D HQK+ R+R+GDI+AIP+G AHWCYN+G+  +V V++ DV++  NQLD
Sbjct  113  --QQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLD 170
Query  188  QKFRAFYLAGGVPRSGEQEQQARQTF-HNIFRAFDAELLSEAFNVPQETIRRMQSEEEER 246
            +  R F+LAG  P+   Q+QQ  Q+   N+F  FD ELL+EAF V +  I++++SE+   
Sbjct  171  RTPRKFHLAGN-PKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRG 229
Query  247  GLIVMARERMTFVRPD----------EEEGEQEHRGR-QLDNGLEETFCTMKFRTNVESR 295
            G++ +  + +  +RP           EEE E E R   Q DNG+EET CTM+++ N+   
Sbjct  230  GIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDP 289
Query  296  READIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGD 355
              ADI++ + GR+  ++   LPILK++ LS EKG LY NALV P W++  H+I+Y  +G 
Sbjct  290  ARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGK 349
Query  356  AQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGY 415
             QVQVVD+ G  + +  V +G+M+VVPQ +    RA    FEW++FKT    M SPLAG 
Sbjct  350  GQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGR 409
Query  416  TSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPG 455
            TSV+  MP +V+ N++QIS   A+ +K N  +Q   L+ G
Sbjct  410  TSVLGGMPEEVLANAFQISREDARKIKFN--NQQTTLTSG 447

Sequence Alignment: 8. Allergen Name: Sin a 2.0101 Sequence ID: Q2TLW0

 Score = 198.4 bits 843,  Expect = 7e-52
 Identities = 174/455 38%, Positives = 280/455 61%, Gaps = 48/455 10%
Query  1    MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQ---QCRFQRISGAQPSLRIQSEGGTTEL 57
            MV +  LL  ++ +L+       R+      Q    C +  +   QP+  I+SE G  E 
Sbjct  1    MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLDVLQPTEVIKSEAGQVEY 60
Query  58   WDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETY--- 114
            WD  + Q +CAG+   R  I+  GL LP +  SP + Y+ +G G+   ++PGCAET+   
Sbjct  61   WDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSSPFISYVVQGMGISGRVIPGCAETFMDS 120
Query  115  QVHRSQRTMERTEASEQQDRGS-------------------------------VRDLHQK 143
            Q  + Q+  ++ +  +Q  +G                                 RD+HQK
Sbjct  121  QPMQGQQGQQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQK 180
Query  144  VHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGVPRSG 203
            V  +R+GD +A+  G+A+W YN G + L+ VS+ D+ +  NQLD+  R F LAG   +  
Sbjct  181  VEHVRHGDAIAMTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQGS 240
Query  204  EQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVRP-- 261
             Q+QQ +Q  +NI+  FD ++L++A+ +     + +Q+++++RG IV  +     VRP  
Sbjct  241  SQQQQQQQ--QNILSGFDPQVLAQALKIDVRLAQELQNQQDKRGNIVRVKGPFQVVRPPL 298
Query  262  -DEEEGEQ-EH-RG---RQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNK 315
                E EQ  H RG      DNGLEET C+M+   N++    ADI+    GRV  V+   
Sbjct  299  RQAYESEQWRHPRGPPQSPQDNGLEETICSMRTHENIDDPARADIYKPNLGRVTSVNSYT 358
Query  316  LPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQ 375
            LPIL+Y+ LSA +G L  +A+V P ++M  + I+Y T+G A++QVV+ NGQ +++ +V +
Sbjct  359  LPILQYIRLSATRGILQGSAMVLPKYNMNANEILYCTQGQARIQVVNDNGQNVLDQQVQK 418
Query  376  GEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISP 435
            G++ V+PQ +    ++ NN FEW++FKT  + M S LAG TS +RA+PL+VITN+YQIS 
Sbjct  419  GQLVVIPQGFAYVVQSQNN-FEWISFKTNANAMISTLAGRTSALRALPLEVITNAYQISL 477
Query  436  NQAQALKMNRGSQSFLLSPGGRR 458
             +A+ +K N    ++  + GG++
Sbjct  478  EEARKIKFNTLETTLTRARGGQQ 500

Sequence Alignment: 9. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 175.2 bits 741,  Expect = 7e-45
 Identities = 187/446 41%, Positives = 297/446 66%, Gaps = 25/446 5%
Query  2    VAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDER 61
            + F +L+  S++ +     +Q R+ +     QC+ Q ++  +P  RI+SE G TE+WD+ 
Sbjct  11   LGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGVTEFWDQN 70
Query  62   QEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQR 121
            +EQ+QCA +   R TI+  GL +P+Y  +P LVY+ +G G+   + PGC ET+Q     R
Sbjct  71   EEQLQCANVAVFRHTIQSRGLLVPSYDNAPELVYVVQGSGIHGAVFPGCPETFQEESQSR 130
Query  122  TMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNH 181
            +  R+E S+Q       + HQKV  +++GD++A+P+G AHW YN+G   LV V++ DV +
Sbjct  131  S--RSERSQQSG-----EQHQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGN 183
Query  182  LSNQLDQKFRAFYLAG---------GVPRSGEQEQQAR-----QTFHNIFRAFDAELLSE 227
              NQLDQ +R F L G         G  RS  Q Q +R     Q  +NI+ AFD E+L++
Sbjct  184  SENQLDQYLRKFVLGGSPQQEIQGSGQSRSRSQSQSSRRGQQGQQSNNILSAFDEEILAQ 243
Query  228  AFNVPQETIRRMQSEEEERGLIVMARERMTFVRPDEEEGEQEH---RGRQLDNGLEETFC 284
            +FN+  +  RR+Q E+ +RG+IV  +E +  + P  +E EQE+   R R+  NGLEETFC
Sbjct  244  SFNIDTQLARRLQKEKRQRGIIVRVQEDLEVLSPHRQEQEQEYEEERERRQRNGLEETFC 303
Query  285  TMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMT 344
            TM ++ N+     AD+++ + GRV  V+   LPIL+++ LSA+KG L+ +A+++P W++ 
Sbjct  304  TMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRFLQLSAKKGVLHRDAILAPHWNVN 363
Query  345  GHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTT 404
             H+IVY+TRG+ ++Q+V  NG+++ ++ + +G++ VVPQ +    RA ++ FEWV+FKT 
Sbjct  364  AHSIVYITRGNGRIQIVSENGESVFDEEIREGQLVVVPQNFAVVKRASSDKFEWVSFKTN 423
Query  405  GSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPG 455
            G    S LAG  SV RA+PL VI NS+ IS   A+ LK +R S++ +++PG
Sbjct  424  GLSQTSQLAGRVSVFRALPLDVIKNSFDISREDARRLKESR-SETTIFAPG 473

Sequence Alignment: 10. Allergen Name: Zan b 2.0101 Sequence ID: QYU76045

 Score = 170.5 bits 720,  Expect = 1e-43
 Identities = 174/369 47%, Positives = 256/369 69%, Gaps = 30/369 8%
Query  51   EGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGC 110
            E G TE+WD+  EQ+QCA +   R  I+  GL +P+Y  +  L Y+ +G+G+   + PGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  111  AETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSED 170
             ETYQ ++ Q++  ++E S  QD+      HQKV +LR+GDIVA+P+G+AHW YN+G   
Sbjct  61   PETYQDQQQQQS-HQSEGSRSQDQ------HQKVRQLREGDIVAVPTGSAHWIYNNGQSQ 113
Query  171  LVAVSINDVNHLSNQLDQKFRAFYLAGGVPRS---GEQEQQARQTFH------------- 214
            LV V++ DV +  NQLDQ +R FY+ GG P+    G  + Q  ++++             
Sbjct  114  LVLVALVDVGNSDNQLDQYLRKFYI-GGNPQQELQGYSQSQGSRSYQGSQGEGSSRRSSG 172
Query  215  -NIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVRPD---EEEGEQEH 270
             NIF  FD  LL++AFNV  E IRR+Q  +  RG+IV   E +  +RP    E+E EQE 
Sbjct  173  GNIFNGFDERLLADAFNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRPQRGQEQEQEQEF 232
Query  271  RGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGN 330
            RGR  DNGLEET+CT+K++ N+ +  +AD+++ + GR+  V+   LP+L+++ LSAEKGN
Sbjct  233  RGR--DNGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGN 290
Query  331  LYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTAR 390
            LY NA ++P W++  H++VYVTRG  +VQ+V  NG  + + ++ +G++ VVPQ Y    R
Sbjct  291  LYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKR 350
Query  391  AGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITN 429
            A N G+EW++FKT  +   S LAG  SVIRA+PL VI N
Sbjct  351  ASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 389

Sequence Alignment: 11. Allergen Name: Zan b 2.0102 Sequence ID: QYU76046

 Score = 169.8 bits 717,  Expect = 2e-43
 Identities = 173/369 46%, Positives = 256/369 69%, Gaps = 29/369 7%
Query  51   EGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGC 110
            E G TE+WD+  EQ+QCA +   R  I+  GL +P+Y  +  L Y+ +G+G+   + PGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  111  AETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSED 170
             ETYQ ++ Q++  ++E S  QD+      HQKV +LR+GDIVA+P+G+AHW YN+G   
Sbjct  61   PETYQDQQQQQS-HQSEGSRSQDQ------HQKVRQLREGDIVAMPTGSAHWIYNNGQSQ 113
Query  171  LVAVSINDVNHLSNQLDQKFRAFYLAGGVPRS---GEQEQQARQTFH------------- 214
            LV V++ DV +  NQLDQ +R FY+ GG P+    G  + Q  ++++             
Sbjct  114  LVLVALVDVGNSDNQLDQYLRKFYI-GGNPQQELQGYSQSQGSRSYQGSQGEGGSRRSSG 172
Query  215  -NIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVRPD--EEEGEQEHR 271
             NIF  FD  LL++AFNV  E IRR+Q  +  RG+IV   E +  +RP   E+E EQE R
Sbjct  173  GNIFNGFDERLLADAFNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRPQRGEQEQEQEFR 232
Query  272  GRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNL 331
            GR  DNGLEET+CT+K++ N+ +  +AD+++ + GR+  V+   LP+L+++ LSAEKGNL
Sbjct  233  GR--DNGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNL 290
Query  332  YSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARA 391
            Y NA ++P W++  H++VYVTRG  +VQ+V  NG  + + ++ +G++ VVPQ Y    +A
Sbjct  291  YQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKKA 350
Query  392  GNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITN 429
             N G+EW++FKT  +   S LAG  SVIRA+PL VI N
Sbjct  351  SNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 388

Sequence Alignment: 12. Allergen Name: Zan b 2.03 Sequence ID: QYS16039

 Score = 162.9 bits 687,  Expect = 3e-41
 Identities = 171/370 46%, Positives = 248/370 67%, Gaps = 28/370 7%
Query  51   EGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGC 110
            E G TE+WD+  +Q+QCA +   R  I+ NGL +P Y  +P L Y+ +G+G+   ++PGC
Sbjct  1    EAGVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGC 60
Query  111  AETYQVHRSQRTMER--TEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGS 168
             ETYQ  + Q+      +E S  QD+      HQKV ++R+GDI+A+P+G+AHW YN+G 
Sbjct  61   PETYQDEQQQQQSFSYPSEGSRSQDQ------HQKVRQIREGDIIALPTGSAHWIYNNGQ 114
Query  169  EDLVAVSINDVNHLSNQLDQKFRAFYLAGGVPR---SGEQEQQ------------ARQTF 213
              LV V++ DV +  NQLDQ FR FYL GG P+    G  + Q            + +  
Sbjct  115  SQLVLVALVDVGNSDNQLDQYFRKFYL-GGNPQPQLQGTSQSQGGRYQERLGGGDSSRRS 173
Query  214  HNIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVRPD--EEEGEQEHR 271
             NIF  FD  LL+EAFNV  E IRR+Q  + +RG+I+   E    + P   +E  E +  
Sbjct  174  ANIFNGFDERLLAEAFNVNPELIRRLQRPQMQRGIIIRVEEEFRVLTPQRGQESYESDPY 233
Query  272  GRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNL 331
            GR   NG+EET+CTM++R N+     AD+++ +AGRV  V+R  LP+L+++ LSAEKGNL
Sbjct  234  GRY--NGVEETLCTMRLRHNINDPSRADVYNPRAGRVTTVNRLNLPVLRWLQLSAEKGNL 291
Query  332  YSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARA 391
            Y NAL +P W++  H+IVY+TRG+ +VQ+V  NG  + +  + +G++ VVPQ +    RA
Sbjct  292  YKNALTAPHWNLNAHSIVYITRGNGRVQIVSENGNNVFDGEIREGQLIVVPQGFAVVKRA 351
Query  392  GNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITN 429
             N G+EW++FKT    M + LAG  SV+RA+PL VI N
Sbjct  352  SNRGLEWISFKTNDYAMTNQLAGRVSVLRALPLDVIQN 389

Sequence Alignment: 13. Allergen Name: Fag e 1 Sequence ID: Q9XFM4

 Score = 163.1 bits 688,  Expect = 3e-41
 Identities = 194/440 44%, Positives = 298/440 67%, Gaps = 73/440 16%
Query  5    KFLLALSLSLLV---SAAI-----AQTREPRLTQGQ---QCRFQRISGAQPSLRIQSEGG 53
            K++L++SL L+V   SA +      Q   P   + Q   QC  QR++ ++PS R++SE G
Sbjct  4    KLILSFSLCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLTASEPSRRVRSEAG 63
Query  54   TTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAET 113
             TE+WD    +F+CAG VA+R  I+P GL LP+Y  +P + ++E+G+G+  ++VPGC ET
Sbjct  64   VTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGCPET 123
Query  114  YQ------VHRSQRTME----------------RTEASEQQDRGSVR------------D 139
            +Q        RSQR                   R   SE+  RG  R            D
Sbjct  124  FQSGSEFEYPRSQRDQRSRQSESGESSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGD 183
Query  140  LHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGV 199
             HQK+ R+R GD++  P+G  +W +N+G  DL+++++ D N + NQLD+  R F+LAG  
Sbjct  184  QHQKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQS 243
Query  200  PRSGEQEQQARQTFH-------------------NIFRAFDAELLSEAF-NVPQETIRRM 239
             +S E  +  RQT                     NI+  F+ E+L E F NV QETI ++
Sbjct  244  KQSREDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETISKL 303
Query  240  QSEEEERGLIVMARERMTFVRPDE-------EEGEQEHRGRQLDNGLEETFCTMKFRTNV 292
            + E ++RG+IV AR+ + +  P+E       E G+++  G    NGLE+ FC +KFR NV
Sbjct  304  RGENDQRGFIVQARD-LKLRVPEEYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFRQNV 362
Query  293  ESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVT 352
                 AD+F+ +AGR++ VD N LPIL+++ LSA+   LY NA++ P W++  H+ +YVT
Sbjct  363  NRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVT 422
Query  353  RGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPL 412
            RG+ +VQVV   G+++ +D V +G+++VVPQ +    +AG  G+EWV +K   + + SP+
Sbjct  423  RGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPI 482
Query  413  AGYTSVIRAMPLQVITNSYQISPNQAQALKMNR 445
            AG TSV+RA+P++V+ NSY IS  +A  LK  R
Sbjct  483  AGKTSVLRAIPVEVLANSYDISTKEAFRLKNGR 515

Sequence Alignment: 14. Allergen Name: Fag e 1 Sequence ID: BAA21758

 Score = 157.4 bits 663,  Expect = 2e-39
 Identities = 192/440 43%, Positives = 301/440 68%, Gaps = 103/440 23%
Query  5    KFLLALSLSLLVSAAIAQ---------TREPRLTQG--QQCRFQRISGAQPSLRIQSEGG 53
            K++L++SL L+V +  AQ         +R  R  Q   +QC  QR++ ++PS R++SE G
Sbjct  4    KLILSFSLCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLTASEPSRRVRSEAG 63
Query  54   TTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAET 113
             TE+WD    +F+CAG VA+R  I+P GL LP+Y  +P + ++E+G+G+  ++VPGC ET
Sbjct  64   VTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGCPET 123
Query  114  YQV---------HRSQRTME-----------RTEASEQQD--RGSVR------------- 138
            +Q          +R QR+ +           RT  SE ++  RG  R             
Sbjct  124  FQSESEFEYPQSQRDQRSRQSESEESSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGD 183
Query  139  -----------------------------DLHQKVHRLRQGDIVAIPSGAAHWCYNDGSE 169
                                         D HQK+ R+R GD++  P+G  +W +NDG  
Sbjct  184  QRTRQSESEEFSRGDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDN 243
Query  170  DLVAVSINDVNHLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFH--------------- 214
            DL+++++ D N + NQLD   R F+LAG   +S E  +  RQT                 
Sbjct  244  DLISITLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDDDEA 303
Query  215  ----NIFRAFDAELLSEAF-NVPQETIRRMQSEEEERGLIVMARERMTFVRPDE------ 263
                NI+  F  E+L E F NV QETI +++ + ++RG+IV AR+ + +  P+E      
Sbjct  304  LLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARD-LKLRVPEEYEEELQ 362
Query  264  -EEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYM 322
             E G+++  G    NGLE+ FC +KF+ NV     AD+F+ +AGR++ V+ N LPIL+++
Sbjct  363  RERGDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFI 422
Query  323  DLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVP 382
             LSA+   LY NA++ P W++  H+ +YVTRG+ +VQVV   G+++ +D V +G+++VVP
Sbjct  423  QLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVP 482
Query  383  QYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALK 442
            Q +    +AG  G+EWV +K   + + SP+AG TSV+RA+P++V+ NSY IS  +A  LK
Sbjct  483  QGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLK 542
Query  443  MNR 445
              R
Sbjct  543  NGR 545

Sequence Alignment: 15. Allergen Name: Jug r 4.0101 Sequence ID: Q2TPW5

 Score = 152.2 bits 640,  Expect = 6e-38
 Identities = 212/450 47%, Positives = 308/450 68%, Gaps = 56/450 12%
Query  2    VAFKFLLALSLSLLVS---AAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELW 58
            +A   LL++ L L+V+     +AQ+   +  Q  QC++ R+   +P+ RI++E G  E W
Sbjct  1    MAKPILLSIYLFLIVALFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNRIEAEAGVIESW 60
Query  59   DERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHR 118
            D   +QFQCAG+  +R TI PNGL LP Y  +P+LVYI RG+G+  ++ PGC ET++   
Sbjct  61   DPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIARGRGITGVLFPGCPETFE--E 118
Query  119  SQRTMERTEASE-QQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSIN 177
            SQR  ++ ++ E QQDR      HQK+  +R+GDI+A P+G AHW YNDGS  +VA+S+ 
Sbjct  119  SQRQSQQGQSREFQQDR------HQKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLL 172
Query  178  DVNHLSNQLDQKFRAFYLAGGV-----P-----------------RSGEQEQQARQTFHN 215
            D N+ +NQLDQ  R FYLAG       P                 R GE+ QQ R   +N
Sbjct  173  DTNNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQRQQRPGEHGQQQRGLGNN 232
Query  216  IFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARER-MTFVRP----DEEEGE--- 267
            +F  FDA++L++AFNV  ET RR+QSE + R  IV    R +  +RP    +E+E E   
Sbjct  233  VFSGFDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERK 292
Query  268  -------------QEHRGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRN 314
                         Q  RG + DNGLEET CT+++R N+     ADI++ +AGR+  V+ +
Sbjct  293  ERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVNSH 352
Query  315  KLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVN 374
             LP+L+++ LSAE+G LYS+AL  P W++  H++VY  RG A+VQVVD+ GQ + +D + 
Sbjct  353  TLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELR 412
Query  375  QGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQIS 434
            +G+++ +PQ +    RA N GFEWV+FKT  + M SPLAG TS IRA+P +V+  ++QI 
Sbjct  413  EGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQIP 472
Query  435  PNQAQALKMNRGSQSFLLS-PGGRRS 459
               A+ LK NR   +++ S P   RS
Sbjct  473  REDARRLKFNRQESTLVRSRPSRSRS 498

Sequence Alignment: 16. Allergen Name: Jug n 4.0101 Sequence ID: A0A1L6K371

 Score = 152.2 bits 640,  Expect = 6e-38
 Identities = 209/452 46%, Positives = 307/452 67%, Gaps = 55/452 12%
Query  2    VAFKFLLALSLSL--LVSAAIAQT---REPRLTQGQQCRFQRISGAQPSLRIQSEGGTTE 56
            +A   LL++SL L  LV+  +AQ+   ++PR+    +C+++R+   +PS RI++E G  E
Sbjct  1    MAKPILLSISLCLVALVNGCLAQSGGRQQPRFG---ECKLKRLVALEPSNRIEAEAGVIE 57
Query  57   LWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQV 116
             WD   +QFQCAG+  +R TI PNGL LP Y  +P+L+YI +G+G+  ++ PGC ET++ 
Sbjct  58   SWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFE- 116
Query  117  HRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSI 176
              SQ+   R   S +      RD HQK+  +R+GD++A P+G AHWCYNDG   +VAV++
Sbjct  117  -ESQQGQSRIRPSLRSASFQ-RDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAVAL 174
Query  177  NDVNHLSNQLDQKFRAFYLAGGV-----P-----------------RSGEQEQQARQTFH 214
             D  + +NQLDQ  R FYLAG       P                 R GE  QQ R + +
Sbjct  175  MDTTNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRHGEPGQQQRGSGN 234
Query  215  NIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARER-MTFVRP----DEEEGE-- 267
            N+F  FDA++L++AFNV  ET RR+QSE + R  IV    R +  +RP    +E+E E  
Sbjct  235  NVFSGFDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREER 294
Query  268  --------------QEHRGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDR 313
                          Q  RG + DNGLEET CT+++R N+     ADI++ +AGR+   + 
Sbjct  295  KERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTANS 354
Query  314  NKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRV 373
            + LP+L+++ LSAE+G LYS+AL  P W++  H++VY  RG A+VQVVD+ GQ + +D +
Sbjct  355  HTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDEL 414
Query  374  NQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQI 433
             +G+++ +PQ +    RA N GFEWV+FKT  + M SPLAG TS IRA+P +V+ N+ QI
Sbjct  415  REGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLANALQI 474
Query  434  SPNQAQALKMNRGSQSFLLS-PGGRRS 459
                A+ LK NR   +++ S P   RS
Sbjct  475  PREDARRLKFNRQESTLVRSRPSSSRS 501

Sequence Alignment: 17. Allergen Name: Car i 4.0101 Sequence ID: ABW86978

 Score = 151.7 bits 638,  Expect = 8e-38
 Identities = 211/449 46%, Positives = 307/449 68%, Gaps = 57/449 12%
Query  2    VAFKFLLALSLSLLVSA----AIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTEL 57
            +A   LL++ L L++ A     +AQ+   +  +  QC++ R+   +P+ RI++E G  E 
Sbjct  1    MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNRIEAEAGVIES 60
Query  58   WDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVH 117
            WD  ++Q+QCAG+  +R TI PNGL LP+Y  +P+LVYI RG+G+  ++ PGC ET++  
Sbjct  61   WDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIARGRGITGVLFPGCPETFE-- 118
Query  118  RSQRTMERTEASE-QQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSI 176
             SQR  ++ +  E QQDR      HQK+  +R+GDI+A P+G AHWCYNDGS  +VA+ +
Sbjct  119  ESQRQSQQGQRREFQQDR------HQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFL 172
Query  177  NDVNHLSNQLDQKFRAFYLAGGV-----P-----------------RSGEQEQQARQTFH 214
             D ++ +NQLDQ  R FYLAG       P                 R GE+ +Q R   +
Sbjct  173  LDTHNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGEQQRDLGN 232
Query  215  NIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARER-MTFVRPDEEEGEQEH--- 270
            N+F  FDAE+L++AFNV  ET RR+QSE + RG IV    R +  +RP     EQEH   
Sbjct  233  NVFSGFDAEFLADAFNVDTETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREEQEHEER 292
Query  271  -----------------RGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDR 313
                             RG + DNGLEET CT+ +R N+     ADI++ +AGR+  V+ 
Sbjct  293  KERERERESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVNS 352
Query  314  NKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRV 373
            + LPIL+++ LSAE+G LYS+AL  P W++  H++VY  RG A+VQVVD+ GQ + +D +
Sbjct  353  HNLPILRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDEL 412
Query  374  NQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQI 433
             +G+++ +PQ +    RA + GFEWV+FKT  + M SPLAG TS IRA+P +V+ N++QI
Sbjct  413  REGQLLTIPQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQI 472
Query  434  SPNQAQALKMNRGSQSFLLSPGGRRS 459
                A+ LK NR  +S L+    R S
Sbjct  473  PREDARRLKFNR-QESTLVRSRSRSS 497

Sequence Alignment: 18. Allergen Name: Cor a 9 Sequence ID: AAL73404

 Score = 146.7 bits 616,  Expect = 3e-36
 Identities = 199/449 44%, Positives = 300/449 66%, Gaps = 46/449 10%
Query  1    MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDE 60
            +V+F + L + ++  +   +   R+ +   G+ C + R++  +P+ RI++E    E WD 
Sbjct  6    LVSFSLCLLVLFNGCLGINVGLRRQQQRYFGE-CNLDRLNALEPTNRIEAEACQIESWDH 64
Query  61   RQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQ 120
              +QFQCAG+  +R TI PNGL LP Y  +P L+YIERG+G+  ++ PGC ET++  + Q
Sbjct  65   NDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFEDPQQQ 124
Query  121  RTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVN 180
                + +   Q  R S +D HQK+  +R+GDI+A+P+G AHWCYNDG   +V VS+   N
Sbjct  125  SQQGQRQGQGQSQR-SEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTN 183
Query  181  HLSNQLDQKFRAFYLAGGVP-----RSGEQE--QQARQTFH---------------NIFR 218
            + +NQLD+  R FYLAG  P     R G+Q+  Q+ RQ  H               N+F 
Sbjct  184  NYANQLDENPRHFYLAGN-PDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFS 242
Query  219  AFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVRPD------------EEEG 266
             FDAE+L++AFNV  +T RR+QS +++R  IV    R+  VRP+            E E 
Sbjct  243  GFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRPERSRQEWERQERQERES 302
Query  267  EQEH--------RGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPI 318
            EQE         RGR + NG+EET C++++R N+ +R  ADI++ Q GR++ V+ N LP+
Sbjct  303  EQERERQRRQGGRGRDV-NGFEETICSLRLRENICTRSRADIYTEQVGRINTVNSNTLPV 361
Query  319  LKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEM 378
            L+++ LSAE+G+L    L  P W++  H++VY  RG A+VQVVD NG  + +D + QG++
Sbjct  362  LRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQV 421
Query  379  FVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQA 438
            + +PQ +    RA + GFEWVAFKT  +   SPLAG TS IRA+P  V+ N++QIS  +A
Sbjct  422  LTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQISREEA 481
Query  439  QALKMNRGSQSFLLS 453
            + LK NR   +++ S
Sbjct  482  RRLKYNRQETTLVRS 496

Sequence Alignment: 19. Allergen Name: Gos h 4 Sequence ID: P09800

 Score = 146.0 bits 613,  Expect = 4e-36
 Identities = 187/419 44%, Positives = 288/419 68%, Gaps = 68/419 16%
Query  22   QTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNG 81
            Q ++P+  +  QC++Q ++  QP  R +SE G TE+WD+ ++QFQCAG+  +R  I+  G
Sbjct  38   QPQQPQPRHQSQCQLQNLNALQPKHRFRSEAGETEFWDQNEDQFQCAGVAFLRHKIQRKG 97
Query  82   LSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRGSVRDLH 141
            L LP++  +P L Y+E+G+G+   + PGC ETYQ  +SQ+ +        QDR   RD H
Sbjct  98   LLLPSFTSAPMLFYVEQGEGIHGAVFPGCPETYQ-SQSQQNI--------QDRPQ-RDQH 147
Query  142  QKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAG---- 197
            QK+ RL++GD+VA+P+G AHW +N+G   LV V++ DV + +NQLD+ FR F+LAG    
Sbjct  148  QKLRRLKEGDVVALPAGVAHWIFNNGRSQLVLVALVDVGNDANQLDENFRKFFLAGSPQG 207
Query  198  GVPRSG-----------------EQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQ 240
            GV R G                 E+E+      +N++  F   LL++AF +     R++Q
Sbjct  208  GVVRGGQSRDRNQRQSRTQRGEREEEESQESGGNNVLSGFRDNLLAQAFGIDTRLARKLQ 267
Query  241  SEEEERGLIVMARERMTFVRPDE--------EEGEQEH---------------------- 270
            +E + RG IV  R    F  P+E        EEGE+E                       
Sbjct  268  NERDNRGAIV--RMEHGFEWPEEGQRRQGREEEGEEEREPKWQRRQESQEEGSEEEEREE 325
Query  271  --RGRQLD-NGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAE 327
              RGR+   NGLEETFC+M+++    +   AD+F+ + GR+  V+   LPIL+Y+ LSAE
Sbjct  326  RGRGRRRSGNGLEETFCSMRLKHRTPASS-ADVFNPRGGRITTVNSFNLPILQYLQLSAE 384
Query  328  KGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTS 387
            +G LY+NA+ +P W+M  H+IVY+TRG+ ++Q+V  NG+A+ +++V +G++  VPQ +  
Sbjct  385  RGVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIVSENGEAIFDEQVERGQVITVPQNHAV 444
Query  388  TARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGS 447
              +AG  GFEW+AFKT  +   S +AG  S++R +P+ V+ NS+ IS  +A  LK NR  
Sbjct  445  VKKAGRRGFEWIAFKTNANAKISQIAGRVSIMRGLPVDVLANSFGISREEAMRLKHNRQE 504
Query  448  QSFLLSP 454
             S ++SP
Sbjct  505  VS-VFSP 510

Sequence Alignment: 20. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 146.0 bits 613,  Expect = 4e-36
 Identities = 196/436 44%, Positives = 294/436 67%, Gaps = 92/436 21%
Query  24   REPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLS 83
            R+ +L+   QC++ ++   +P  RIQ+E G  E W+  Q  FQCAG+ A R TI+ NGL 
Sbjct  2    RQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLH 61
Query  84   LPNYHPSPRLVYIERGQGLISIMVPGCAETY----------------------------- 114
            LP+Y  +P+L+YI +G+G++  +  GC ET+                             
Sbjct  62   LPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGR 121
Query  115  ---QVHRSQRTMERTEASEQQDRGSVR-------------------DLHQKVHRLRQGDI 152
               Q  + Q    R +  +QQ+ G  +                   D HQK  R+R+GD+
Sbjct  122  QQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDV 181
Query  153  VAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGV-----------PR 201
            VAIP+G A+W YNDG ++LVAV++  V+   NQLDQ  R FYLAG             PR
Sbjct  182  VAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPR 241
Query  202  S-GEQEQ--QARQTF------------HNIFRAFDAELLSEAFNVPQETIRRMQSEEEER 246
              GEQ +  Q +Q F            +N+F  F+ +LL++A+NV +ET R +Q + + R
Sbjct  242  QQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNR 301
Query  247  GLIVMARERMTFVRPDEEEGEQEHRGRQ---------------LDNGLEETFCTMKFRTN 291
              I+  R  + FV+P     E+EH  RQ               + NGLEETFC+++++ N
Sbjct  302  NQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMANGLEETFCSLRLKEN 361
Query  292  VESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYV 351
            + +   ADIFS +AGR+  ++ + LPIL+++ LSAE+G +Y N + SP W++  H++VYV
Sbjct  362  IGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYV 421
Query  352  TRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSP 411
             RG+A+VQVV+ NG A+++  V QG++F+VPQ +    +AGN GFE+ AFKT  +   + 
Sbjct  422  IRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINT 481
Query  412  LAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS 459
            LAG TS +RA+P +V+ N+YQIS  QA+ LK NR     L S   RR+
Sbjct  482  LAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRA 529

Sequence Alignment: 21. Allergen Name: Fag e 1 Sequence ID: BAA21760

 Score = 145.5 bits 611,  Expect = 6e-36
 Identities = 182/440 41%, Positives = 295/440 67%, Gaps = 39/440 8%
Query  5    KFLLALSLSLLVSAAIAQTREPRLTQG-------------QQCRFQRISGAQPSLRIQSE 51
            K++L++SL L+V +  AQ    +  QG             +QC  QR++ ++PS R++SE
Sbjct  4    KLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQRLTASEPSRRVRSE 63
Query  52   GGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCA 111
             G TE+WD    +F+C G VA+R  I+P GL LP+Y  +P + ++E+G+G+  +++PGC 
Sbjct  64   AGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVIPGCP 123
Query  112  ETYQVH------RSQRTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYN 165
            ET+Q        +SQR    +  SE ++  S  D HQK+ R+R+GD++  P+G  +W +N
Sbjct  124  ETFQSDSEFEYPQSQRG-RHSRQSESEEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHN 182
Query  166  DGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFH----------N 215
            DG++DL++V++ D N    QLD+  R+F+LAG   R   +E   RQ+            N
Sbjct  183  DGNDDLISVTLLDANSYHKQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGAN 242
Query  216  IFRAFDAELLSEAF-NVPQETIRRMQSEEEERGLIVMARERMTFVRPD-EEEGEQEHRGR 273
            I+  F  E+L E F +V +ETI +++ E ++RG+IV A++    V  D EEE E+E   R
Sbjct  243  ILSGFQDEILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRVPQDFEEEYERERGDR 302
Query  274  QL-------DNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSA 326
            +         NG+E+ FC +KFR N  +     +F+ +AGR++ V+ N LPIL+++ LSA
Sbjct  303  RRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSA 362
Query  327  EKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYT 386
            +   LY NA++ P W++  H+ +YVTRG+ +VQVV   G+++ +D+V +G+++VVPQ + 
Sbjct  363  QHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFA 422
Query  387  STARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNR 445
               +AG  G+EWV +K +G+ + SP+ G TSV+RA+P++V+ NSY IS  +A  LK  R
Sbjct  423  VVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGR 481

Sequence Alignment: 22. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 145.3 bits 610,  Expect = 7e-36
 Identities = 203/457 44%, Positives = 308/457 67%, Gaps = 93/457 20%
Query  2    VAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDER 61
            +A  F+++L L L+ +  +A  R+ +L+   QC++ ++   +P  RIQ+E G  E W+  
Sbjct  1    MAKAFVFSLCLLLVFNGCLA-ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFN 59
Query  62   QEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETY------- 114
            QE FQCAG+ A R TI+ NGL LP+Y  +P+L+YI +G+G++  +  GC ET+       
Sbjct  60   QEDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSS 119
Query  115  -------------------------QVHRSQRTMERTEASEQQDRGSVR----------- 138
                                     Q  + Q    R +  +QQ+ G  +           
Sbjct  120  QQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQ 179
Query  139  --------DLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKF 190
                    D HQK  R+R+GD+VAIP+G A+W YNDG ++LVAV++  V+   NQLDQ  
Sbjct  180  QQQQFRQFDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNP 239
Query  191  RAFYLAGGV-----------PRS-GEQ-------------EQQARQ-TFHNIFRAFDAEL 224
            R FYLAG             PR  GEQ              QQ +Q + +N+F  F+ +L
Sbjct  240  RKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQL 299
Query  225  LSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVRPDEEEGEQEHRGRQ---------- 274
            L++A+NV +ET R +Q + + R  I+  R  + FV+P     E+EH  RQ          
Sbjct  300  LAQALNVNEETARNLQGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQ 359
Query  275  -----LDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKG 329
                 + NGLEETFC+++++ N+ +   ADIFS +AGR+  ++ + LPIL+++ LSAE+G
Sbjct  360  QGGQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERG 419
Query  330  NLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTA 389
             +Y N + SP W++  H++VYV RG+A+VQVV+ NG A+++  V QG++F+VPQ +    
Sbjct  420  FFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQ 479
Query  390  RAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQS 449
            +AGN GFE+ AFKT  +   + LAG TS +RA+P +V+ N+YQIS  QA+ LK NR    
Sbjct  480  QAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETI 539
Query  450  FLLSPGGRRS 459
             L S   RR+
Sbjct  540  ALSSSQQRRA 549

Sequence Alignment: 23. Allergen Name: Gos h 3 Sequence ID: P09802

 Score = 141.9 bits 595,  Expect = 7e-35
 Identities = 200/437 45%, Positives = 303/437 69%, Gaps = 68/437 15%
Query  7    LLALSLSLLVSAAIA-QTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQF 65
            LL LSL +L +  +A QT   + +Q + C+  R+  + P  RI+SE GTTE W+   +Q+
Sbjct  7    LLFLSLLFLFNGCLARQTFSSQQSQNE-CQINRLRASAPQTRIRSEAGTTEWWNPNCQQL 65
Query  66   QCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMER 125
            +CAG+  MR TI PNGL LP++  +P+L+YI +G+G+  I++PGCAET+Q   SQ+    
Sbjct  66   RCAGVSVMRQTIEPNGLVLPSFTNAPQLLYIVQGRGIQGIVMPGCAETFQ--DSQQW--- 120
Query  126  TEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQ 185
                ++Q RG  +D HQKV R+RQGDI+A+P G  HW YNDG+E +V +++ D  + +NQ
Sbjct  121  ----QHQSRGRFQDQHQKVRRFRQGDIIALPQGVVHWSYNDGNERVVTINLLDTGNSANQ 176
Query  186  LDQKFRAFYLAG-----------------GVPRSGEQ----------------------- 205
            LD   R F+LAG                 G    GE+                       
Sbjct  177  LDNIPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESEEEEGEGEEEEEEDNPSRRSRH 236
Query  206  ---EQQARQT--FHNIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVR 260
               E+Q R++   +N++ AFD  +L++AFNV ++ IR++Q     RG I+  R+R+  V 
Sbjct  237  QEEEEQGRESSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQRVRGNRGTIIRVRDRLQVVT 296
Query  261  P---DEEEGE---QEHRGRQL-----DNGLEETFCTMKFRTNVESRREADIFSRQAGRVH 309
            P   +EEE E   QE+R R+      DNGLEETFC+M+ + N+     ADIF+ QAGR+ 
Sbjct  297  PPRMEEEEREERQQEQRYRHTRGGSQDNGLEETFCSMRIKENLADPERADIFNPQAGRIS 356
Query  310  VVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALM 369
             ++R  LPIL+ ++LSAE+G LY+ A + P W++  H I+Y+ RG A+VQVV+HNG A+ 
Sbjct  357  TLNRFNLPILQRLELSAERGVLYNRAGLIPQWNVNAHKILYMLRGCARVQVVNHNGDAVF 416
Query  370  NDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITN 429
            +D V QG+++ VPQ +    +AGN G EW++F T      +P+AG  S +RA+P +V+  
Sbjct  417  DDNVEQGQLLTVPQNFAFMKQAGNEGAEWISFFTNSEATNTPMAGSVSFMRALPEEVVAA 476
Query  430  SYQISPNQAQALKMNRGSQSFLLSP 454
            SYQ+S   A+ +K N    +F+++P
Sbjct  477  SYQVSREDARRIKFN-NKNTFFFTP 500

Sequence Alignment: 24. Allergen Name: Pru du 6.0201 Sequence ID: ADN39441

 Score = 140.3 bits 588,  Expect = 2e-34
 Identities = 199/444 44%, Positives = 307/444 69%, Gaps = 54/444 12%
Query  12   LSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIV 71
            L LL +  +A +R+  + Q ++ ++ ++   +P   IQSE G TE W+    QFQ AG+ 
Sbjct  2    LLLLFNGCLA-SRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
Query  72   AMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETY------QVHRSQRTME- 124
             +R TI PNGL LP+Y  +P+L+YI RG+G++  + PGCAET+      Q ++ Q+  + 
Sbjct  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
Query  125  ---RTEASE--QQDRG-SVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSIND 178
               R E  +  QQ +G   +D HQK+  +R+GDI+A+P+G A+W YN+G + LVAVS+ D
Sbjct  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
Query  179  VNHLSNQLDQKFRAFYLAGGV-----PRS-GEQEQQARQ----TFHNIFRAFDAELLSEA 228
            +N+  NQLDQ  R FYLAG       P+  G Q+QQ +Q      +NIF  FD +LL++A
Sbjct  181  LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA 240
Query  229  FNVPQETIRRMQSEEEERGLIVMARERMTFVRP------------------------DEE 264
            +NV  ET R +Q +++ R  IV  + ++ FV P                        +E+
Sbjct  241  LNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEK 300
Query  265  EGEQEHRGRQ-LDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMD 323
            + EQE++G    DNG+EETFC+ ++  N+     AD ++ Q GR+ VV+RN LPIL+Y+ 
Sbjct  301  QREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLR 360
Query  324  LSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQ 383
            LSAEKG LY+NA+ +P W    + +VY  RG+A+VQVV+ NG  +++D V +G++F++PQ
Sbjct  361  LSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQ 420
Query  384  YYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKM 443
             +    +A N GFE+++F+T  +   + LAG TSV+RA+P +V+ N+++IS  +A+ LK 
Sbjct  421  NHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY 480
Query  444  NRGSQSFLLS----PGGR 457
            NR  +S LLS    P GR
Sbjct  481  NR-QESRLLSATSPPRGR 497

Sequence Alignment: 25. Allergen Name: Pis v 5.0101 Sequence ID: EU410073

 Score = 139.4 bits 584,  Expect = 4e-34
 Identities = 193/437 44%, Positives = 290/437 66%, Gaps = 33/437 7%
Query  7    LLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQ 66
            LL+LS+ LL+          +  Q  +C+  ++   +P  R++ E G  E WD  +EQF+
Sbjct  6    LLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFR 65
Query  67   CAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERT 126
            CAG+   R TI+PNGL LP Y  +P L+YI  G+G+   ++PGC ETYQ    Q+  +  
Sbjct  66   CAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQA--PQQGQQHG 123
Query  127  EASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQL 186
            ++S  QD+      HQK++R+R+GDI+A+P+G A+WCYN+G+  +V V++ DV++  NQL
Sbjct  124  QSSRFQDK------HQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQL 177
Query  187  DQKFRAFYLAGGVPRSGEQEQQARQT----------FHNIFRAFDAELLSEAFNVPQETI 236
            D   R F LAG  P    Q+QQ +Q+           +NIF  FD ++L+E F V Q  +
Sbjct  178  DMYPRKFNLAGN-PEDEFQQQQQQQSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLV 236
Query  237  RRMQSEEEERGLIVMARERMTFVRP----------DEEEGEQEHRGRQ-LDNGLEETFCT 285
            +++Q+E++ RG IV  +  +  +RP           EEE E E RGR+  DNGLEET CT
Sbjct  237  KQLQNEKDNRGAIVKVKGDLQVIRPPRRQSERGFESEEESEYE-RGRRGRDNGLEETICT 295
Query  286  MKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTG 345
            MK++ N+     +DI++ + GR+  ++   LPILK++ LSAE+G L +NAL+ P W+   
Sbjct  296  MKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNA 355
Query  346  HTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTG 405
            H+IVY  +G+AQVQVVD+ G  + +  V++G++FVVPQ +    RA    FEW++FKT  
Sbjct  356  HSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFEWISFKTND 415
Query  406  SPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPG 455
              M SPLAG TSV+RAMP +V+ N++QIS   A+ +K N  ++   LS G
Sbjct  416  RAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFN--NEQPTLSSG 463

Sequence Alignment: 26. Allergen Name: Ara h 3 Sequence ID: O82580

 Score = 110.2 bits 456,  Expect = 3e-25
 Identities = 176/418 42%, Positives = 256/418 61%, Gaps = 75/418 17%
Query  34   CRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRL 93
            C+FQR++  +P  RI+SEGG  E W+   ++F+CAG+   R  +R N L  P Y  +P+ 
Sbjct  9    CQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQE 68
Query  94   VYIERGQGLISIMVPGCAETYQV-H------RSQRTMERTEASEQQDRGSVRDLHQKVHR 146
            ++I++G+G   ++ PGC   Y+  H      +SQR   R +  +Q  +   RD HQKVHR
Sbjct  69   IFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQ--RDSHQKVHR 126
Query  147  LRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGV------- 199
            + +GD++A+P+G A W YND   D+VAVS+ D N+  NQLDQ  R F LAG         
Sbjct  127  FDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRY 186
Query  200  ----------------------PRSGEQE-----QQARQTFH---------NIFRAFDAE 223
                                  PR  E+E     Q++R+            NIF  F  E
Sbjct  187  QQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPE 246
Query  224  LLSEAFNVPQETIR---RMQSEEEERGLIVMARERMTFVRPD--------EEEGEQEH-- 270
            +L +AF V    I    R ++E EE G IV  R  +  + PD        EE  E E+  
Sbjct  247  FLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEY 306
Query  271  ------RGRQL---DNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKY 321
                  RGR      NG+EET CT   + N+   R  DI++ QAG +   +   L IL++
Sbjct  307  DEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRW 366
Query  322  MDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVV 381
            +  SAE GNLY NAL    ++   H+I+Y  RG A+VQVVD NG  + ++ + +G ++VV
Sbjct  367  LGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVV 426
Query  382  PQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQAL 441
            PQ +    ++ +  FE+VAFKT   P  + LAG  SVI  +P +V+ NSY +   QA+ L
Sbjct  427  PQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQL 486
Query  442  KMNRGSQSFLLSP 454
            K N     F++ P
Sbjct  487  K-NNNPFKFFVPP 498

Sequence Alignment: 27. Allergen Name: Ara h 3 Sequence ID: AAC63045

 Score = 110.2 bits 456,  Expect = 3e-25
 Identities = 176/418 42%, Positives = 256/418 61%, Gaps = 75/418 17%
Query  34   CRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRL 93
            C+FQR++  +P  RI+SEGG  E W+   ++F+CAG+   R  +R N L  P Y  +P+ 
Sbjct  12   CQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQE 71
Query  94   VYIERGQGLISIMVPGCAETYQV-H------RSQRTMERTEASEQQDRGSVRDLHQKVHR 146
            ++I++G+G   ++ PGC   Y+  H      +SQR   R +  +Q  +   RD HQKVHR
Sbjct  72   IFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQ--RDSHQKVHR 129
Query  147  LRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGV------- 199
            + +GD++A+P+G A W YND   D+VAVS+ D N+  NQLDQ  R F LAG         
Sbjct  130  FDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFLRY 189
Query  200  ----------------------PRSGEQE-----QQARQTFH---------NIFRAFDAE 223
                                  PR  E+E     Q++R+            NIF  F  E
Sbjct  190  QQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPE 249
Query  224  LLSEAFNVPQETIR---RMQSEEEERGLIVMARERMTFVRPD--------EEEGEQEH-- 270
            +L +AF V    I    R ++E EE G IV  R  +  + PD        EE  E E+  
Sbjct  250  FLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKRRADEEEEYDEDEYEY 309
Query  271  ------RGRQL---DNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKY 321
                  RGR      NG+EET CT   + N+   R  DI++ QAG +   +   L IL++
Sbjct  310  DEEDRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTANDLNLLILRW 369
Query  322  MDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVV 381
            +  SAE GNLY NAL    ++   H+I+Y  RG A+VQVVD NG  + ++ + +G ++VV
Sbjct  370  LGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVV 429
Query  382  PQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQAL 441
            PQ +    ++ +  FE+VAFKT   P  + LAG  SVI  +P +V+ NSY +   QA+ L
Sbjct  430  PQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQARQL 489
Query  442  KMNRGSQSFLLSP 454
            K N     F++ P
Sbjct  490  K-NNNPFKFFVPP 501

Sequence Alignment: 28. Allergen Name: Gly m 6.0501 Sequence ID: Q7GC77

 Score = 109.8 bits 454,  Expect = 4e-25
 Identities = 163/435 37%, Positives = 277/435 63%, Gaps = 86/435 19%
Query  7    LLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQ 66
            L +L L LL SA  A T     ++  +C++  ++  +P  R++SEGG  E W+ ++ ++Q
Sbjct  10   LSSLCLLLLSSACFAITS----SKFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQ 65
Query  67   CAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERT 126
            CAG+   + T+  NGL LP+Y P P+++ + +G+G I    PGC ET++    Q++  R 
Sbjct  66   CAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFE-KPQQQSSRRG 124
Query  127  EASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQL 186
              S+QQ    ++D HQK+  + +GD++ IP G  +W YN G E +VA+S+ D ++++NQL
Sbjct  125  SRSQQQ----LQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQL 180
Query  187  DQKFRAFYLAGGV----PRSGEQEQQAR------QTFH--------NIFRAFDAELLSEA 228
            DQ  R FYLAG      P + +Q+QQ +      Q  H        +++  F   +L+++
Sbjct  181  DQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEEEGGSVLSGFSKHFLAQS 240
Query  229  FNVPQETIRRMQSEEEERGLIVMARERMTFVRP------DEEEGE--------------- 267
            FN  ++T  +++S ++ER  IV     ++ + P      DE+E E               
Sbjct  241  FNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRP 300
Query  268  --------------------------------QEHRGR--QLDNGLEETFCTMKFRTNVE 293
                                            QE RGR  Q  NG+EE  CTMK+  N+ 
Sbjct  301  SHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIA 360
Query  294  SRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTR 353
                AD ++ +AGR+  ++   LP L+   LSA+   LY N + SP W++  ++++YVTR
Sbjct  361  RPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTR 420
Query  354  GDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLA 413
            G  +V+VV+  G A+ +  + +G+++VVPQ +    + G  G+E+V FKT  + + S + 
Sbjct  421  GKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYI- 479
Query  414  GYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSP 454
                V RA+P +V++NSY +  +Q + LK  +G+   L++P
Sbjct  480  --KDVFRAIPSEVLSNSYNLGQSQVRQLKY-QGNSGPLVNP 517

Sequence Alignment: 29. Allergen Name: Gly m 6.0301 Sequence ID: P11828

 Score = 107.7 bits 445,  Expect = 1e-24
 Identities = 166/436 38%, Positives = 273/436 62%, Gaps = 48/436 11%
Query  5    KFLLALSLSLLVSAAIAQT-REPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQE 63
            K++L+L + L+     A + RE    Q  +C+ QR++  +P  RI+SEGG  E W+   +
Sbjct  3    KLVLSLCFLLFSGCCFAFSFREQ--PQQNECQIQRLNALKPDNRIESEGGFIETWNPNNK 60
Query  64   QFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTM 123
             FQCAG+   R T+  N L  P+Y  +P+ +YI++G G+  ++ PGC  T++        
Sbjct  61   PFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFE-----EPQ 115
Query  124  ERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLS 183
            ++ ++S  QDR      HQK++ +R+GD++A+P+G A+W YN+    +VAVS+ D N + 
Sbjct  116  QKGQSSRPQDR------HQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQ 169
Query  184  NQLDQKFRAFYLAGGV--------PRS---GEQEQQAR--QTFHN----IFRAFDAELLS 226
            NQLDQ  R FYLAG          P+    G Q Q+ +  Q   N    I+  F  E+L 
Sbjct  170  NQLDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGFAPEFLE 229
Query  227  EAFNVPQETIRRMQ--SEEEERGLIVMARERMTFVRPDEEEGEQ--------------EH 270
             AF V ++ +R++Q  +EEEE+G IV  +  ++ + P  EE +Q              +H
Sbjct  230  HAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEEKPDCDEKDKH 289
Query  271  RGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGN 330
               Q  NG++ET CTM++R N+      DIF+ QAG +       +P L ++ LSA+ G+
Sbjct  290  CQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGS 349
Query  331  LYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTAR 390
            L  NA+  P +++  ++I+Y   G A VQVV+ NG+ + +  + +G++++VPQ +   AR
Sbjct  350  LRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNFAVAAR 409
Query  391  AGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSF 450
            + ++ FE+V+FKT   P    LAG  S++ A+P +VI  ++ +   QA+ +K N    SF
Sbjct  410  SQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRRQQARQVK-NNNPFSF 468
Query  451  LLSP 454
            L+ P
Sbjct  469  LVPP 472

Sequence Alignment: 30. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 107.7 bits 445,  Expect = 2e-24
 Identities = 157/436 36%, Positives = 274/436 62%, Gaps = 119/436 27%
Query  7    LLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQ 66
            L +L L LL SA  A +     ++  +C++  ++  +P  R++SEGG  + W+ ++ +++
Sbjct  9    LSSLCLLLLSSACFAISS----SKLNECQLNNLNALEPDHRVESEGGLIQTWNSQHPELK 64
Query  67   CAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERT 126
            CAG+   + T+  NGL LP+Y P PR++ I +G+G + + +PGC ET++  + Q     +
Sbjct  65   CAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQSNRRGS 124
Query  127  EASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQL 186
             + +QQ    ++D HQK+  + +GD++ IP G  +W YN G E +VA+S+ D ++++NQL
Sbjct  125  RSQKQQ----LQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQL 180
Query  187  DQKFRAFYLAGG----VPRSGEQEQQAR------QTFH---------NIFRAFDAELLSE 227
            DQ  R FYLAG      P + +Q+QQ +      Q  H         +++  F   +L++
Sbjct  181  DQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQ 240
Query  228  AFNVPQETIRRMQSEEEERGLIVMARERMTFVRP------DEEEGEQE------------ 269
            +FN  ++   ++QS ++ER  IV     ++ + P      DE+E E E            
Sbjct  241  SFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP 300
Query  270  ----HRGRQLD------------------------------------------------- 276
                H  R+ D                                                 
Sbjct  301  RRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQ 360
Query  277  -----------------NGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPIL 319
                             NG+EE  CT+K+  N+     AD ++ +AGR+  ++   LP L
Sbjct  361  PRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPAL 420
Query  320  KYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMF 379
            +   LSA+   LY N + SP W++  ++++YVTRG  +V+VV+  G A+ +  + +G+++
Sbjct  421  RQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLL 480
Query  380  VVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQ 439
            VVPQ +    +AG  GFE++ FKT  + + S L     V RA+P +V+ +SY +  +Q  
Sbjct  481  VVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVS 537
Query  440  ALKMNRGSQSFLLSP 454
             LK   G+   L++P
Sbjct  538  ELKYE-GNWGPLVNP 551

Sequence Alignment: 31. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 106.8 bits 441,  Expect = 3e-24
 Identities = 169/439 38%, Positives = 275/439 62%, Gaps = 56/439 12%
Query  5    KFLLALSLSLLVSAAIA-QTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQE 63
            K++++L + L+     A  +RE    Q  +C+ Q+++  +P  RI+SEGG  E W+   +
Sbjct  3    KLVFSLCFLLFSGCCFAFSSREQ--PQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK 60
Query  64   QFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTM 123
             FQCAG+   R T+  N L  P+Y   P+ +YI++G+G+  ++ PGC  T++    Q+  
Sbjct  61   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFE--EPQQPQ 118
Query  124  ERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLS 183
            +R ++S  QDR      HQK++ +R+GD++A+P+G A W YN+    +VAVSI D N L 
Sbjct  119  QRGQSSRPQDR------HQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLE 172
Query  184  NQLDQKFRAFYLAGGVPR---------SGEQEQQAR--QTFHN----IFRAFDAELLSEA 228
            NQLDQ  R FYLAG   +          G Q Q+ +  Q   N    I+  F  E+L  A
Sbjct  173  NQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHA 232
Query  229  FNVPQETIRRMQSEEE--ERGLIVMARERMTFV---------RPDEEEGEQE-------- 269
            F+V ++  + +Q E E  ++G IV  +  ++ +         RP EEE E+E        
Sbjct  233  FSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKG 292
Query  270  ---H----RGRQLD---NGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPIL 319
               H    RG Q     NG++ET CTM++R N+      DI++ QAG V       +P L
Sbjct  293  KDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPAL 352
Query  320  KYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMF 379
             ++ LSAE G+L  NA+  P +++  ++I+Y   G A +QVV+ NG+ + +  + +G ++
Sbjct  353  SWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVL 412
Query  380  VVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQ 439
            +VPQ +   AR+ ++ FE+V+FKT  +PM   LAG  S++ A+P +VI +++ +   QA+
Sbjct  413  IVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQAR 472
Query  440  ALKMNRGSQSFLLSP 454
             +K N     FL+ P
Sbjct  473  QIK-NNNPFKFLVPP 486

Sequence Alignment: 32. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 106.8 bits 441,  Expect = 3e-24
 Identities = 169/439 38%, Positives = 275/439 62%, Gaps = 56/439 12%
Query  5    KFLLALSLSLLVSAAIA-QTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQE 63
            K++++L + L+     A  +RE    Q  +C+ Q+++  +P  RI+SEGG  E W+   +
Sbjct  3    KLVFSLCFLLFSGCCFAFSSREQ--PQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK 60
Query  64   QFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTM 123
             FQCAG+   R T+  N L  P+Y   P+ +YI++G+G+  ++ PGC  T++    Q+  
Sbjct  61   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFE--EPQQPQ 118
Query  124  ERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLS 183
            +R ++S  QDR      HQK++ +R+GD++A+P+G A W YN+    +VAVSI D N L 
Sbjct  119  QRGQSSRPQDR------HQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLE 172
Query  184  NQLDQKFRAFYLAGGVPR---------SGEQEQQAR--QTFHN----IFRAFDAELLSEA 228
            NQLDQ  R FYLAG   +          G Q Q+ +  Q   N    I+  F  E+L  A
Sbjct  173  NQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHA 232
Query  229  FNVPQETIRRMQSEEE--ERGLIVMARERMTFV---------RPDEEEGEQE-------- 269
            F+V ++  + +Q E E  ++G IV  +  ++ +         RP EEE E+E        
Sbjct  233  FSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKG 292
Query  270  ---H----RGRQLD---NGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPIL 319
               H    RG Q     NG++ET CTM++R N+      DI++ QAG V       +P L
Sbjct  293  KDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPAL 352
Query  320  KYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMF 379
             ++ LSAE G+L  NA+  P +++  ++I+Y   G A +QVV+ NG+ + +  + +G ++
Sbjct  353  SWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVL 412
Query  380  VVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQ 439
            +VPQ +   AR+ ++ FE+V+FKT  +PM   LAG  S++ A+P +VI +++ +   QA+
Sbjct  413  IVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQAR 472
Query  440  ALKMNRGSQSFLLSP 454
             +K N     FL+ P
Sbjct  473  QIK-NNNPFKFLVPP 486

Sequence Alignment: 33. Allergen Name: Ara h 4 Sequence ID: AAD47382

 Score = 106.1 bits 438,  Expect = 5e-24
 Identities = 175/441 39%, Positives = 271/441 61%, Gaps = 80/441 18%
Query  8    LALSLSLLV--SAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQF 65
            L++ + +LV  +++I+  ++P   +   C+FQR++  +P  RI+SEGG  E W+   ++F
Sbjct  7    LSFCFCFLVLGASSISFRQQP---EENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEF 63
Query  66   QCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQV-------HR 118
            +CAG+   R  +R N L  P Y  +P+ ++I++G+G   ++ PGC  TY+        ++
Sbjct  64   ECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQ 123
Query  119  SQRTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSIND 178
            SQR   R +  +Q  +   +D HQKVHR+ +GD++A+P+G A W YND   D+VAVS+ D
Sbjct  124  SQRPPRRLQEEDQSQQQ--QDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTD 181
Query  179  VNHLSNQLDQKFRAFYLAGG-----------------------------VPRSGEQE--- 206
             N+  NQLDQ  R F LAG                               PR  E+E   
Sbjct  182  TNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRP 241
Query  207  --QQARQTFH---------NIFRAFDAELLSEAFNVPQETIRRM---QSEEEERGLIVMA 252
              Q++R+            NIF  F  E+L +AF V    I +    ++E EE G IV  
Sbjct  242  RGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTV 301
Query  253  RERMTFVRPD-------EEEGEQEH---------RGRQL---DNGLEETFCTMKFRTNVE 293
            R  +  + PD       EEE ++++         RGR      NG+EET CT   + N+ 
Sbjct  302  RGGLRILSPDGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGGNGIEETICTACVKKNIG 361
Query  294  SRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTR 353
              R   I+  Q    +      L IL+++ LSAE GNLY NAL  P ++   H+I+Y  R
Sbjct  362  GNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALR 421
Query  354  GDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLA 413
            G A+VQVVD NG  + ++ + +G ++VVPQ +    ++ +  FE+VAFKT   P  + +A
Sbjct  422  GRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFA 481
Query  414  GYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSP 454
            G  S I  +P +V+ NSY +   QA+ LK N     F++ P
Sbjct  482  GENSFIDNLPEEVVANSYGLPREQARQLK-NNNPFKFFVPP 521

Sequence Alignment: 34. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 105.2 bits 434,  Expect = 8e-24
 Identities = 170/436 38%, Positives = 265/436 60%, Gaps = 48/436 11%
Query  8    LALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQC 67
            L LSL +L+ +     RE    Q  +C+ Q+++  +P  RI+SEGG  E W+   + FQC
Sbjct  4    LVLSLCFLLFSGCFALREQ--AQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQC 61
Query  68   AGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTE 127
            AG+   R T+  N L  P+Y   P+ +YI++G G+  ++ PGC  TYQ    Q + +R  
Sbjct  62   AGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQ--EPQESQQRGR 119
Query  128  ASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLD 187
            +   QDR      HQKVHR+R+GD++A+P+G A W YN+    +VAVSI D N L NQLD
Sbjct  120  SQRPQDR------HQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLD 173
Query  188  QKFRAFYLAGGVPR----------SGEQEQQARQTFH-----NIFRAFDAELLSEAFNVP 232
            Q  R FYLAG   +           G Q Q+ +Q        NI+  F  E+L EAF V 
Sbjct  174  QMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVN 233
Query  233  QETIRRMQ--SEEEERGLIVMARERMTFVRP------------DEEEGEQ--------EH 270
             + +R +Q  +EEE+ G IV  +  +    P            DEEE  Q        + 
Sbjct  234  MQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQR 293
Query  271  RGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGN 330
            + ++  NG++ET CTM++R N+      DI++ QAG +       +P L  + LSA+ G+
Sbjct  294  QSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGS 353
Query  331  LYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTAR 390
            L  NA+  P +++  ++I+Y   G A VQVV+ NG+ + +  + +G +++VPQ +   A+
Sbjct  354  LRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAK 413
Query  391  AGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSF 450
            + ++ FE+V+FKT   P    LAG  S++ A+P +VI +++ +   QA+ +K N    SF
Sbjct  414  SQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVK-NNNPFSF 472
Query  451  LLSP 454
            L+ P
Sbjct  473  LVPP 476

Sequence Alignment: 35. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 105.2 bits 434,  Expect = 8e-24
 Identities = 170/436 38%, Positives = 265/436 60%, Gaps = 48/436 11%
Query  8    LALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQC 67
            L LSL +L+ +     RE    Q  +C+ Q+++  +P  RI+SEGG  E W+   + FQC
Sbjct  4    LVLSLCFLLFSGCFALREQ--AQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQC 61
Query  68   AGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTE 127
            AG+   R T+  N L  P+Y   P+ +YI++G G+  ++ PGC  TYQ    Q + +R  
Sbjct  62   AGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQ--EPQESQQRGR 119
Query  128  ASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLD 187
            +   QDR      HQKVHR+R+GD++A+P+G A W YN+    +VAVSI D N L NQLD
Sbjct  120  SQRPQDR------HQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLD 173
Query  188  QKFRAFYLAGGVPR----------SGEQEQQARQTFH-----NIFRAFDAELLSEAFNVP 232
            Q  R FYLAG   +           G Q Q+ +Q        NI+  F  E+L EAF V 
Sbjct  174  QMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVN 233
Query  233  QETIRRMQ--SEEEERGLIVMARERMTFVRP------------DEEEGEQ--------EH 270
             + +R +Q  +EEE+ G IV  +  +    P            DEEE  Q        + 
Sbjct  234  MQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQR 293
Query  271  RGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGN 330
            + ++  NG++ET CTM++R N+      DI++ QAG +       +P L  + LSA+ G+
Sbjct  294  QSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGS 353
Query  331  LYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTAR 390
            L  NA+  P +++  ++I+Y   G A VQVV+ NG+ + +  + +G +++VPQ +   A+
Sbjct  354  LRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAK 413
Query  391  AGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSF 450
            + ++ FE+V+FKT   P    LAG  S++ A+P +VI +++ +   QA+ +K N    SF
Sbjct  414  SQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVK-NNNPFSF 472
Query  451  LLSP 454
            L+ P
Sbjct  473  LVPP 476

Sequence Alignment: 36. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 49.8 bits 191,  Expect = 4e-07
 Identities = 89/295 30%, Positives = 154/295 52%, Gaps = 52/295 17%
Query  146  RLRQGDIVAIPSGAAHWCYN-DGSEDL-VAVSINDVNHLSNQLDQKFRAFYLAGGV-PRS 202
            RL+ G + AIP+G++ +  N D SE L +  SI+ +  +        ++FY+ GGV PRS
Sbjct  132  RLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESM-EYYGAYPQSFYVGGGVLPRS 190
Query  203  GEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIR------------RMQSEEEER---- 246
                         ++  FDA  LS AFNV  + +             R+  E  E+    
Sbjct  191  -------------VLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYL 237
Query  247  GLIVMARERMTFVRP----DEEEGEQEHRGRQ-----LDNGLEETFCTMKFRTNVE---- 293
              I+  +ERM   +     D++E EQE          L + L +  C ++ +  +     
Sbjct  238  SSIMQLKERMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPG 297
Query  294  SRREADI---FSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVY 350
            S    D    +    G    +D +    LK+ +L     NL + A++SP  + T      
Sbjct  298  SYNLYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGI 357
Query  351  VTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNG-FEWVAFKTTGSPMR 409
            + RG   +QVV  NG A MN +V++G++F +P+Y+     A +   +E+  F T+    R
Sbjct  358  ILRGSGTIQVVFPNGTAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNR 417
Query  410  SP-LAGYTSVIRAMPLQVITNSYQISPNQAQAL-KMNRGSQSFLLSP 454
               L G +S++ +M    +  ++ +S  Q + + K  R +  +  SP
Sbjct  418  PQFLVGKSSLLHSMRGPELAAAFGVSEEQLERIVKAQREAVILPTSP 464

Sequence Alignment: 37. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 46.6 bits 177,  Expect = 4e-06
 Identities = 98/374 26%, Positives = 188/374 50%, Gaps = 96/374 25%
Query  24   REPRLTQGQQCRFQRISGAQPSLRI--QSEGGTT---ELWDERQEQFQCAGIVAMRSTI- 77
            RE R  + +Q R         S+R   +SE G     E + ER E ++  GI   R  I 
Sbjct  167  RESRGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLR--GIENYRVVIL 224
Query  78   --RPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRG 135
               PN   LP++  +  +  + RG+  ++++            SQ T E           
Sbjct  225  DANPNTSMLPHHKDAESVAVVTRGRATLTLV------------SQETRESFN-------- 264
Query  136  SVRDLHQKVHRLRQGDIVAIPSGAAHWCYN-DGSEDLVAVSINDVNHLSNQLDQKFRAFY 194
                       L  GD++ +P+GA  +  N D +E L  V +  +  ++N    +FR +Y
Sbjct  265  -----------LECGDVIRVPAGATVYVINQDSNERLEMVKL--LQPVNNP--GQFREYY 309
Query  195  LAGGVPRSGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQSEEEER-GLIVMA- 252
             AG   +S +Q         + +R F  ++L  A+N P++ + R   ++E+R G+I+ A 
Sbjct  310  AAGA--KSPDQ---------SYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRAS 358
Query  253  RERMTFVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVD 312
            +E++  +        Q   GR+   G             +  + E+  +S Q G+     
Sbjct  359  QEKLRALSQHAMSAGQRPWGRRSSGG------------PISLKSESPSYSNQFGQFFEAC 406
Query  313  RNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVV-------DHNG 365
              +   L+ MD+      +   A++ P ++     +VYV  G  + ++         + G
Sbjct  407  PEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYEG 466
Query  366  QAL--------------MNDRVNQGEMFVVPQYYTSTARAGNN-GFEWVAFKTTG-SPMR 409
            Q                +  R+ +G++FV+P  +     A  N  +  + F   G +  R
Sbjct  467  QGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQR 526
Query  410  SPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS 459
              LAG  ++I  +  +    S+ +   + + +  ++    F+  P  R+S
Sbjct  527  DFLAGQNNIINQLEREAKELSFNMPREEIEEIFESQMESYFV--PTERQS 574

Sequence Alignment: 38. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 44.3 bits 167,  Expect = 3e-05
 Identities = 100/373 26%, Positives = 191/373 51%, Gaps = 99/373 26%
Query  24   REPRLTQGQQCRFQRISGAQPSLRIQSEGGTTEL-----WDERQEQFQCAGIVAMRSTI- 77
            RE R  + +Q R          LR + E G  E+     + ER E ++  GI   R  I 
Sbjct  364  RESRGREEEQQRHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLR--GIENYRVVIL 421
Query  78   --RPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRG 135
               PN + LP +  +  ++ + RG+  ++ +               + ER E+       
Sbjct  422  EANPNTFVLPYHKDAESVIVVTRGRATLTFV---------------SQERRES------- 459
Query  136  SVRDLHQKVHRLRQGDIVAIPSGAAHWCYN-DGSEDLVAVSINDVNHLSNQLDQKFRAFY 194
                       L  GD++ +P+GA  +  N D +E L  V +  +  ++N    +FR +Y
Sbjct  460  ---------FNLEYGDVIRVPAGATEYVINQDSNERLEMVKL--LQPVNNP--GQFREYY 506
Query  195  LAGGVPRSGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQSEEEER-GLIVMA- 252
             AG             Q+  + +R F  ++L  A+N P++ + R   ++E+R G+I+ A 
Sbjct  507  AAGA------------QSTESYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRAS 554
Query  253  RERMTFVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVD 312
            +E++  +        Q   GR+   G            +++S+R +  +S Q G+     
Sbjct  555  QEKLRALSQHAMSAGQRPWGRRSSGG----------PISLKSQRSS--YSNQFGQFFEAC 602
Query  313  RNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRG----------DAQVQVVD 362
              +   L+ MD+      +   A++ P ++     +VYV  G          D   Q  +
Sbjct  603  PEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVSSQSYE 662
Query  363  HNGQALMND-------------RVNQGEMFVVPQYYTSTARAGNN-GFEWVAFKTTG-SP 407
            + G+    +             R+ +G++FV+P  +     A  N  +  V F   G + 
Sbjct  663  YKGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNN 722
Query  408  MRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS 459
             R+ LAG  ++I  +  +    S+ + P +       R  +S+++ P  R+S
Sbjct  723  QRNFLAGQNNIINQLEREAKELSFNM-PREEIEEIFERQVESYFV-PMERQS 772

Sequence Alignment: 39. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 42.8 bits 160,  Expect = 5e-05
 Identities = 98/374 26%, Positives = 190/374 50%, Gaps = 96/374 25%
Query  24   REPRLTQGQQCRFQRISGAQPSLRI--QSEGGTT---ELWDERQEQFQCAGIVAMRSTI- 77
            RE +  + +Q R         S+R   +SE G     E + ER E ++  GI   R  I 
Sbjct  55   RESKGREEEQQRHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLR--GIENYRVVIL 112
Query  78   --RPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRG 135
               PN + LP++  +  ++ + RG+  ++++            SQ T E           
Sbjct  113  DANPNTFMLPHHKDAESVIVVTRGRATLTLV------------SQETRESFN-------- 152
Query  136  SVRDLHQKVHRLRQGDIVAIPSGAAHWCYN-DGSEDLVAVSINDVNHLSNQLDQKFRAFY 194
                       L  GD++ +P+GA  +  N D +E L  V +  +  ++N    + R +Y
Sbjct  153  -----------LECGDVIRVPAGATEYVINQDSNERLEMVKL--LQPVNNP--GQVREYY 197
Query  195  LAGGVPRSGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQSEEEER-GLIVMA- 252
             AG   +S +Q         + +R F  ++L  A+N P++ + R   ++E+R G+I+ A 
Sbjct  198  AAGA--KSPDQ---------SYLRVFSNDILVAALNTPRDRLERFFDQQEQREGVIIRAS 246
Query  253  RERMTFVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVD 312
            +E++  +        Q   GR+   G            +++S R +  +S Q G+     
Sbjct  247  QEKLRALSQHAMSAGQRPWGRRSSGG----------PISLKSERPS--YSNQFGQFFEAC 294
Query  313  RNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVV-DHNGQALMND 371
              +   L+ MD+      +   A++ P ++     +VYV  G  + ++   H       D
Sbjct  295  PEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFED 354
Query  372  --------------------RVNQGEMFVVPQYYTSTARAGNN-GFEWVAFKTTG-SPMR 409
                                R+ +G++FV+P  +     A  N  +  + F   G +  R
Sbjct  355  QGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQR 414
Query  410  SPLAGYTSVIRAMPLQVITNSYQISPNQAQALKMNRGSQSFLLSPGGRRS 459
            + LAG  S+I  +  +    S+ +   + + +  ++    F+  P  R+S
Sbjct  415  NFLAGQNSIINQLEREAKELSFNMPREEIEEIFESQMESYFV--PTERQS 462

Sequence Alignment: 40. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 42.3 bits 158,  Expect = 7e-05
 Identities = 71/299 23%, Positives = 143/299 47%, Gaps = 26/299 8%
Query  135  GSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFY 194
            G + D      RL+ GD+  IPSG+A +  N G    + V I  ++  ++   + F++FY
Sbjct  102  GFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHV-ICSIDPSTSLGLETFQSFY 160
Query  195  LAGGVPR----SGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIV 250
            + GG       SG  E    +T  N  R    E++S+ ++ P   +   ++      ++ 
Sbjct  161  IGGGANSHSVLSGF-EPAILETAFNESRTVVEEIFSKELDGPIMFVDDSHAPSLWTKFLQ 219
Query  251  MARE----RMTFVRPDEEEGEQEHR-GRQLDNGLEETFCTMKFRT------------NVE 293
            + ++    ++  +  D+EE E+E +  R     LE  F  +  +             N+ 
Sbjct  220  LKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNLY 279
Query  294  SRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTR 353
              ++AD F    G    +   + P L   D+      L + ++++P  +        V  
Sbjct  280  DDKKAD-FKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTIVLS 338
Query  354  GDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARAGNNG-FEWVAFKTTGSPMRSP- 411
            G  ++++   NG   M  ++ QG++FVVP+Y+     A  +G +E+  F T+    +   
Sbjct  339  GYGELHIGYPNGSRAMKTKIKQGDVFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKPQF 398
Query  412  LAGYTSVIRAMPLQVITNSYQISPN 436
            LAG  S++R +    ++ ++ +S +
Sbjct  399  LAGAASLLRTLMGPELSAAFGVSED 423

Sequence Alignment: 41. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 40.0 bits 148,  Expect = 0.0004
 Identities = 54/180 30%, Positives = 99/180 55%, Gaps = 23/180 12%
Query  59   DERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPR-LVYIERGQGLISIMVPGCAETYQVH 117
            D++  Q+Q   ++     I+   L LP+++     +V + +G G + ++        Q +
Sbjct  420  DKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVA---VRKEQQQ 476
Query  118  RSQRTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAH-WCYNDGSE-DLVAVS 175
            R +R  E  E  ++++ GS R++ +   RL++GD+  +P  AAH    N  SE  L+   
Sbjct  477  RGRR--EEEEDEDEEEEGSNREVRRYTARLKEGDVFIMP--AAHPVAINASSELHLLGFG 532
Query  176  IN-DVNHL-------SNQLDQ-KFRAFYLAGGVPRSGEQ-EQQARQTFHNIFRAFDAELL 225
            IN + NH         N +DQ + +A  LA   P SGEQ E+  +    + F +   +  
Sbjct  533  INAENNHRIFLAGDKDNVIDQIEKQAKDLA--FPGSGEQVEKLIKNQKESHFVSARPQSQ 590
Query  226  SEAFNVPQ-ETIRRMQSEEEERG 247
            S++ + P+ E+  +   EEE +G
Sbjct  591  SQSPSSPEKESPEKEDQEEENQG 613

Sequence Alignment: 42. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 38.8 bits 143,  Expect = 0.0009
 Identities = 49/187 26%, Positives = 99/187 52%, Gaps = 30/187 16%
Query  59   DERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPR-LVYIERGQGLISIMVPGCAETYQVH 117
            D++  Q+Q   ++     I+   L LP+++     +V + +G G + ++        Q +
Sbjct  412  DKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVA---VRKEQQQ 468
Query  118  RSQRTMERTEASE-QQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSI 176
            R +R  E  E  E +++ GS R++ +   RL++GD+  +P  AAH    + S +L  +  
Sbjct  469  RGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMP--AAHPVAINASSELHLLGF 526
Query  177  NDVNHLSNQLDQKFRAFYLAGGVPRSGEQ-EQQARQTFHNIFRAFDAELLSEAFNVPQET 235
              +N  +N+     R F LAG      +Q E+QA+                 AF    E 
Sbjct  527  G-INAENNH-----RIF-LAGDKDNVIDQIEKQAKDL---------------AFPGSGEQ 564
Query  236  IRRMQSEEEERGLIVMARERMTFVRPDEEEGEQEHRG 272
            + ++   + E  ++    +  +   P++E+ E+E++G
Sbjct  565  VEKLIKNQRESHFVSARPQSQSPSSPEKEDQEEENQG 601

Sequence Alignment: 43. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 36.9 bits 134,  Expect = 0.003
 Identities = 54/211 25%, Positives = 103/211 48%, Gaps = 30/211 14%
Query  147  LRQGDIVAIPSGAAHWCYN-DGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGVPRSGEQ 205
            L +GD + +P+G   +  N D +EDL    + D+    N+  Q +++F L      SG Q
Sbjct  92   LERGDTIKLPAGTIAYLANRDDNEDL---RVLDLAIPVNRPGQ-LQSFLL------SGTQ 141
Query  206  EQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQSEEEE-----RGLIVMARERMT--- 257
             Q +       +  F   +L  AFN   E I ++  EE+E     R  +   R+ +T   
Sbjct  142  NQPS------FLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNED 195
Query  258  -FVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKL 316
              V+   E+ E+  +  +  +  +++  +     N+ SR    I+S + G+   +   K 
Sbjct  196  VIVKVSREQIEELSKNAKSSS--KKSVSSESEPFNLRSRNP--IYSNKFGKFFEITPEKN 251
Query  317  PILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQG 376
            P L+ +D+      +   +L+ P+++     IV V  G    ++V +  +     R    
Sbjct  252  PQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREEND 311
Query  377  E 377
            E
Sbjct  312  E 312

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.