The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVDAAVLEKLEAGFAKLAASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLEN
HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEYI
ISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQK
LIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLG
QVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEEV
AGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL
Sequence Info Allergen Name Length Opt Bits Score E Value
ABC86902 Bla g 9.0101 356 2377 548.3 1.9e-157
ABB88514 Bomb m 1.0101 355 2101 485.3 1.6e-138
Q95PM9 Plo i 1 355 2086 481.9 1.7e-137
H6VGI3 Scy p 2.0101 357 1997 461.6 2.2e-131
Q004B5 Lit v 2.0101 356 1983 458.4 2e-130
AAO15713 Pen m 2 356 1974 456.4 8.4e-130
H6VGI2 Pro c 2.0101 357 1972 455.9 1.2e-129
A0A868BHP5 Tyr p 20.0101 357 1842 426.3 9.7e-121
AIO08850 Der f 20.0101 356 1816 420.4 5.9e-119
ACD50950 Der p 20.0101 356 1783 412.9 1.1e-116
ABU97470 Der f 20.0201 356 1775 411.0 3.8e-116
XP_026780620 Pan h 7.0101 380 942 221.1 5.9e-59
ACH70914 Sal s 7.01 381 919 215.9 2.3e-57
E2JE77 Mac r 2.0101 355 866 203.8 9e-54
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bla g 9.0101 Sequence ID: ABC86902

 Score = 548.3 bits 2377,  Expect = 2e-157
 Identities = 356/356 100%, Positives = 356/356 100%, Gaps = 0/356 0%
Query  1    MVDAAVLEKLEAGFAKLAASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLEN 60
            MVDAAVLEKLEAGFAKLAASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLEN
Sbjct  1    MVDAAVLEKLEAGFAKLAASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLEN 60
Query  61   HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEYI 120
            HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEYI
Sbjct  61   HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEYI 120
Query  121  ISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQK 180
            ISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQK
Sbjct  121  ISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQK 180
Query  181  LIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLG 240
            LIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLG
Sbjct  181  LIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLG 240
Query  241  QVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEEV 300
            QVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEEV
Sbjct  241  QVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEEV 300
Query  301  AGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            AGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL
Sbjct  301  AGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356

Sequence Alignment: 2. Allergen Name: Bomb m 1.0101 Sequence ID: ABB88514

 Score = 485.3 bits 2101,  Expect = 2e-138
 Identities = 309/355 87%, Positives = 335/355 94%, Gaps = 1/355 0%
Query  1    MVDAAVLEKLEAGFAKLAASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLEN 60
            MVDAA LEKLEAGF+KL  SDSKSLL+KYLT+EVFD+LK KKT +FGSTLLD IQSG+EN
Sbjct  1    MVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKT-SFGSTLLDCIQSGVEN 59
Query  61   HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEYI 120
             DSGVGIYAPDAE+Y+VFA+LFDPIIEDYH GFKKTDKHPPK+WGDVDTLGNLDPAGE++
Sbjct  60   LDSGVGIYAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFV 119
Query  121  ISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQK 180
            +STRVRCGRS++GYPFNPCLTE+QYKEMEDKVS TLS LEGELKG FYPLTGM+KE QQ+
Sbjct  120  VSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQ 179
Query  181  LIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLG 240
            LIDDHFLFKEGDRFLQ ANACRFWPTGRGIYHN+ KTFLVWCNEEDHLRIISMQMGGDL 
Sbjct  180  LIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQ 239
Query  241  QVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEEV 300
            QVY+RLV+AVN+IEK++PFSH DRLGFLTFCPTNLGTTVRASV IK+PKLAADKKKLEEV
Sbjct  240  QVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAADKKKLEEV 299
Query  301  AGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            A KY+LQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVK M DGIAELIKIE SL
Sbjct  300  ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 355

Sequence Alignment: 3. Allergen Name: Plo i 1 Sequence ID: Q95PM9

 Score = 481.9 bits 2086,  Expect = 2e-137
 Identities = 308/355 86%, Positives = 333/355 93%, Gaps = 1/355 0%
Query  1    MVDAAVLEKLEAGFAKLAASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLEN 60
            MVDAA LEKLEAGF+KLAASDSKSLL+KYLT+EVFD LK KKT +FGSTLLD IQSG+EN
Sbjct  1    MVDAATLEKLEAGFSKLAASDSKSLLKKYLTREVFDALKNKKT-SFGSTLLDSIQSGVEN 59
Query  61   HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEYI 120
              SGVGIYAPDAEAY VFADLFDPIIEDYH GFKKTDKHPPK+WGDV+TLGNLDPAGE++
Sbjct  60   LHSGVGIYAPDAEAYVVFADLFDPIIEDYHNGFKKTDKHPPKNWGDVETLGNLDPAGEFV 119
Query  121  ISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQK 180
            +STRVRCGRSM+GYPFNPCLTEAQYKEME+KVSSTLSGLEGELKG F+PLTGM+KE QQ+
Sbjct  120  VSTRVRCGRSMEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGELKGTFFPLTGMSKETQQQ 179
Query  181  LIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLG 240
            LIDDHFLFKEGDRFLQ ANACRFWP+GRGIYHN+ KTFLVWCNEEDHLR+ISMQMGGDL 
Sbjct  180  LIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLK 239
Query  241  QVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEEV 300
            QVY+RLV  VNDI KR+PFSH++RLGFLTFCPTNLGTTVRASV IK+PKLAADK KLEEV
Sbjct  240  QVYKRLVRGVNDIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEV 299
Query  301  AGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            A KY+LQVRGTRGEHTEAEGGVYDISNKRRMGLTEY+AVK M DGIAELIKIE SL
Sbjct  300  ASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELIKIEKSL 355

Sequence Alignment: 4. Allergen Name: Scy p 2.0101 Sequence ID: H6VGI3

 Score = 461.6 bits 1997,  Expect = 2e-131
 Identities = 298/355 83%, Positives = 328/355 92%, Gaps = 2/355 0%
Query  1    MVDAAVLEKLEAGFAKL-AASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLE 59
            M DAAV+EKLE GF KL AA+D KSLL+KYLTK VFD LK KKT ++G+TLLDVIQSG+E
Sbjct  1    MADAAVIEKLEEGFKKLEAATDCKSLLKKYLTKSVFDQLKGKKT-SLGATLLDVIQSGVE 59
Query  60   NHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEY 119
            N DSGVG+YAPDAEAYT+FA LFDPIIEDYH GFK+TDKHP KD+GDV+ + N+DP G++
Sbjct  60   NLDSGVGVYAPDAEAYTLFAPLFDPIIEDYHKGFKQTDKHPNKDFGDVNQFVNVDPDGKF 119
Query  120  IISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQ 179
            +ISTRVRCGRSM+GYPFNPCLTEAQYKEME KVSSTLS LEGELKG +YPLTGMTK+VQQ
Sbjct  120  VISTRVRCGRSMEGYPFNPCLTEAQYKEMESKVSSTLSNLEGELKGTYYPLTGMTKDVQQ 179
Query  180  KLIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDL 239
            KLIDDHFLFKEGDRFLQ ANACR+WPTGRGIYHND KTFLVWCNEEDHLRIISMQMGGDL
Sbjct  180  KLIDDHFLFKEGDRFLQAANACRYWPTGRGIYHNDNKTFLVWCNEEDHLRIISMQMGGDL 239
Query  240  GQVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEE 299
            GQVYRRLV+AVN+IEKRVPFSH DRLGFLTFCPTNLGTTVRASV IK+PKLAA+++KLEE
Sbjct  240  GQVYRRLVSAVNEIEKRVPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEE 299
Query  300  VAGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            VAGKY+LQVRGTRGEHTEAEGGVYDISNKRRMGLTE+ AVK M DGI ELIKIE  +
Sbjct  300  VAGKYSLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM 356

Sequence Alignment: 5. Allergen Name: Lit v 2.0101 Sequence ID: Q004B5

 Score = 458.4 bits 1983,  Expect = 2e-130
 Identities = 294/355 82%, Positives = 328/355 92%, Gaps = 2/355 0%
Query  1    MVDAAVLEKLEAGFAKL-AASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLE 59
            M DAAV+EKLEAGF KL AA+D KSLL+KYLTKEVFD LK K+T ++G+TLLDVIQSG+E
Sbjct  1    MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRT-SLGATLLDVIQSGVE 59
Query  60   NHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEY 119
            N DSGVGIYAPDAEAYT+FA LFDPIIEDYH GFK+TDKHP KD+GDV+++ N+DP G++
Sbjct  60   NLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKF 119
Query  120  IISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQ 179
            +ISTRVRCGRS+QGYPFNPCLTE+QYKEME KVSSTLS LEGELKG +YPLTGM+KEVQQ
Sbjct  120  VISTRVRCGRSLQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQ 179
Query  180  KLIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDL 239
            KLIDDHFLFKEGDRFLQ ANACR+WP GRGIYHND KTFLVW NEEDHLRIISMQMGGDL
Sbjct  180  KLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDL 239
Query  240  GQVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEE 299
            GQV+RRL +AVN+IEKR+PFSH DRLGFLTFCPTNLGTTVRASV IK+PKLAA+++KLEE
Sbjct  240  GQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEE 299
Query  300  VAGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            VAGKYNLQVRGTRGEHTEAEGG+YDISNKRRMGLTE+ AVK M DGI ELIKIE  +
Sbjct  300  VAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM 356

Sequence Alignment: 6. Allergen Name: Pen m 2 Sequence ID: AAO15713

 Score = 456.4 bits 1974,  Expect = 8e-130
 Identities = 293/355 82%, Positives = 326/355 91%, Gaps = 2/355 0%
Query  1    MVDAAVLEKLEAGFAKL-AASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLE 59
            M DAAV+EKLEAGF KL AA+D KSLL+KYL+K VFD LK KKT ++G+TLLDVIQSG+E
Sbjct  1    MADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKT-SLGATLLDVIQSGVE 59
Query  60   NHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEY 119
            N DSGVGIYAPDAEAYT+F+ LFDPIIEDYH GFK+TDKHP KD+GDV+T+ N+DP G+Y
Sbjct  60   NLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKY 119
Query  120  IISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQ 179
            +ISTRVRCGRSM+GYPFNPCLTEAQYKEME KVSSTLS LEGELKG +YPLTGM+KEVQQ
Sbjct  120  VISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQ 179
Query  180  KLIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDL 239
            KLIDDHFLFKEGDRFLQ ANACR+WP GRGIYHND KTFLVW NEEDHLRIISMQMGGDL
Sbjct  180  KLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDL 239
Query  240  GQVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEE 299
            GQV+RRL +AVN+IEKR+PFSH DRLGFLTFCPTNLGTT RASV IK+PKLAA+++KLEE
Sbjct  240  GQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTARASVHIKLPKLAANREKLEE 299
Query  300  VAGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            VAGKYNLQVRGTRGEHTEAEGG+YDISNKRRMGLTE+ AVK M DGI ELIK+E  +
Sbjct  300  VAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM 356

Sequence Alignment: 7. Allergen Name: Pro c 2.0101 Sequence ID: H6VGI2

 Score = 455.9 bits 1972,  Expect = 1e-129
 Identities = 291/355 81%, Positives = 325/355 91%, Gaps = 2/355 0%
Query  1    MVDAAVLEKLEAGFAKL-AASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLE 59
            M DAA + KLE GF KL AA+D KSLL+KYL+K +FD+LK KKT  +G+TLLDVIQSG+E
Sbjct  1    MADAATIAKLEEGFKKLEAATDCKSLLKKYLSKSIFDSLKAKKTG-LGATLLDVIQSGVE 59
Query  60   NHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEY 119
            N DSGVGIYAPDAEAY++FA LFDPIIEDYH GFK+TDKHP KD+GDV+ + N+DP G++
Sbjct  60   NLDSGVGIYAPDAEAYSLFAPLFDPIIEDYHKGFKQTDKHPNKDFGDVNQFVNVDPDGKF 119
Query  120  IISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQ 179
            +ISTRVRCGRS++GYPFNPCLTEAQYKEME+KVSSTLSGLEGELKG +YPL GMTKEVQQ
Sbjct  120  VISTRVRCGRSLEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGELKGTYYPLAGMTKEVQQ 179
Query  180  KLIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDL 239
            KLIDDHFLFKEGDRFLQ ANACR+WP GRGIYHND KTFLVWCNEEDHLRIISMQMGGDL
Sbjct  180  KLIDDHFLFKEGDRFLQAANACRYWPVGRGIYHNDNKTFLVWCNEEDHLRIISMQMGGDL 239
Query  240  GQVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEE 299
            GQVYRRLV+AVNDIEKRVPFSH DRLGFLTFCPTNLGTT+RASV IK+PKLAA+++KLEE
Sbjct  240  GQVYRRLVSAVNDIEKRVPFSHHDRLGFLTFCPTNLGTTIRASVHIKLPKLAANREKLEE 299
Query  300  VAGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            VA +Y+LQVRGTRGEHTEAEGGVYDISNKRRMGLTE+ AVK M DGI ELIKIE  +
Sbjct  300  VAARYSLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM 356

Sequence Alignment: 8. Allergen Name: Tyr p 20.0101 Sequence ID: A0A868BHP5

 Score = 426.3 bits 1842,  Expect = 1e-120
 Identities = 274/355 77%, Positives = 309/355 87%, Gaps = 3/355 0%
Query  1    MVDAAVLEKLEAGFAKLAASDS--KSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGL 58
            MVD A L+KLEAGF KL +S     SLL+KYLT++VF+ LK KKT   G+TLLDVIQSG+
Sbjct  1    MVDQATLDKLEAGFKKLQSSGDACHSLLKKYLTEDVFNKLKDKKTG-MGATLLDVIQSGV 59
Query  59   ENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGE 118
            EN DSGVG+YAPDAEAYT+FADLF+P+IE YHGGFK TDKHPP D+GD++ L N+DP  E
Sbjct  60   ENLDSGVGLYAPDAEAYTLFADLFNPVIEGYHGGFKSTDKHPPSDFGDINQLVNVDPNNE 119
Query  119  YIISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQ 178
            ++ISTRVRCGRS+QGYPFNPCLTEAQYKEME+KV + L  +EGELKG +YPLTGM K  Q
Sbjct  120  FVISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKAQLESFEGELKGTYYPLTGMDKATQ 179
Query  179  QKLIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGD 238
            Q+LIDDHFLFKEGDRFLQ ANACRFWPTGRGI+HN +KTFL+W NEEDHLRIISMQ GGD
Sbjct  180  QQLIDDHFLFKEGDRFLQAANACRFWPTGRGIFHNASKTFLMWVNEEDHLRIISMQKGGD 239
Query  239  LGQVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLE 298
            L +V+ RLV AV  IEK++PFS DDRLGFLTFCPTNLGTT+RASV IK+PKLAAD+KKLE
Sbjct  240  LKEVFGRLVKAVQHIEKKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLE 299
Query  299  EVAGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            EVA KYNLQVRGT GEHTE+ GGVYDISNKRRMGLTEY AVK M DGI ELIKIE SL
Sbjct  300  EVAAKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSL 357

Sequence Alignment: 9. Allergen Name: Der f 20.0101 Sequence ID: AIO08850

 Score = 420.4 bits 1816,  Expect = 6e-119
 Identities = 267/355 75%, Positives = 306/355 86%, Gaps = 2/355 0%
Query  1    MVDAAVLEKLEAGFAKLAAS-DSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLE 59
            MVD AV++KLEAGF KL +S +  SLL+KYLT+ V+D  K +KT   G+TL+DV+QSG+E
Sbjct  1    MVDQAVIDKLEAGFQKLQSSAECHSLLKKYLTRNVLDACKGRKTG-MGATLVDVVQSGFE 59
Query  60   NHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEY 119
            N DSGVG+YAPDAE+YT+F +LFDP+IEDYH GFK TDKHP  D+GDV+TL N+DP  E+
Sbjct  60   NLDSGVGLYAPDAESYTLFKELFDPVIEDYHKGFKPTDKHPQTDFGDVNTLCNVDPNNEF 119
Query  120  IISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQ 179
            +ISTRVRCGRS+QGYPFNPCLTEAQYKEME+KV   L+ +EGELKG +YPL GM K  QQ
Sbjct  120  VISTRVRCGRSLQGYPFNPCLTEAQYKEMEEKVKGQLNSFEGELKGTYYPLLGMDKATQQ 179
Query  180  KLIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDL 239
            +LIDDHFLFKEGDRFLQ ANACRFWP G GI+HND KTFL+W NEEDHLRIISMQ GGDL
Sbjct  180  QLIDDHFLFKEGDRFLQAANACRFWPVGCGIFHNDNKTFLIWVNEEDHLRIISMQKGGDL 239
Query  240  GQVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEE 299
             QV+ RL+  VN IEK++PFS DDRLGFLTFCPTNLGTT+RASV IK+PKLAAD+KKLEE
Sbjct  240  KQVFSRLINGVNHIEKKLPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 299
Query  300  VAGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            VAGKYNLQVRGT GEHTE+ GGVYDISNKRRMGLTEY AVK M DGI ELIKIE S+
Sbjct  300  VAGKYNLQVRGTAGEHTESVGGVYDISNKRRMGLTEYQAVKEMQDGILELIKIEKSM 356

Sequence Alignment: 10. Allergen Name: Der p 20.0101 Sequence ID: ACD50950

 Score = 412.9 bits 1783,  Expect = 1e-116
 Identities = 264/355 74%, Positives = 300/355 84%, Gaps = 2/355 0%
Query  1    MVDAAVLEKLEAGFAKLA-ASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLE 59
            MVD A L KLEAGF KL  A D  SLL+KYLT++VFD LK KKT   G+TLLDVIQSG+E
Sbjct  1    MVDPATLSKLEAGFQKLQNAQDCHSLLKKYLTRDVFDQLKNKKTD-MGATLLDVIQSGVE 59
Query  60   NHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEY 119
            N DSGVGIYAPDA++Y  FA LFDPII+DYH GFK TDKHP  D+G+++ + N+DP  EY
Sbjct  60   NLDSGVGIYAPDAQSYKTFAALFDPIIDDYHKGFKPTDKHPKTDFGNIENFVNVDPKNEY 119
Query  120  IISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQ 179
            ++STRVRCGRS+ GYPFNP LTEAQYKEME KV   L+ +EGELKG +YPL GM K  QQ
Sbjct  120  VLSTRVRCGRSLNGYPFNPMLTEAQYKEMETKVKGQLATFEGELKGTYYPLLGMDKATQQ 179
Query  180  KLIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDL 239
            +LIDDHFLFKEGDRFLQ ANACR+WP GRGI+HND KTFL+W NEEDHLRIISMQ GGDL
Sbjct  180  QLIDDHFLFKEGDRFLQAANACRYWPVGRGIFHNDKKTFLMWVNEEDHLRIISMQKGGDL 239
Query  240  GQVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEE 299
             +VY RLV AV  IE+++PFS DDRLGFLTFCPTNLGTT+RASV IK+PKLAAD+KKLEE
Sbjct  240  KEVYGRLVKAVKHIEQKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 299
Query  300  VAGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            VAG+YNLQVRGT GEHTE+ GG+YDISNKRRMGLTEY AVK M DGI ELIK+E S+
Sbjct  300  VAGRYNLQVRGTAGEHTESVGGIYDISNKRRMGLTEYQAVKEMQDGILELIKMEKSM 356

Sequence Alignment: 11. Allergen Name: Der f 20.0201 Sequence ID: ABU97470

 Score = 411.0 bits 1775,  Expect = 4e-116
 Identities = 264/355 74%, Positives = 301/355 84%, Gaps = 2/355 0%
Query  1    MVDAAVLEKLEAGFAKLA-ASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLE 59
            MVD A L KLEAGF KL  A D  SLL+KYLT++V+D LKTKKT   G+TLLDVIQSG+E
Sbjct  1    MVDQATLSKLEAGFQKLQNAQDCHSLLKKYLTRDVLDQLKTKKTD-MGATLLDVIQSGVE 59
Query  60   NHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPKDWGDVDTLGNLDPAGEY 119
            N DSGVGIYAPDA++Y  FA LFDPII+DYH GFK TDKHP  D+G+++ + N+DP  EY
Sbjct  60   NLDSGVGIYAPDAQSYKTFAALFDPIIDDYHKGFKPTDKHPQTDFGNIEHFVNVDPKNEY 119
Query  120  IISTRVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQ 179
            +ISTRVRCGRS++GYPFNP LTEAQYKEME KV   L+ +EGELKG +YPL GM K  QQ
Sbjct  120  VISTRVRCGRSLKGYPFNPMLTEAQYKEMETKVKGQLATFEGELKGTYYPLLGMDKATQQ 179
Query  180  KLIDDHFLFKEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDL 239
            KLIDDHFLFKEGDRFLQ ANACR+WP GRGI+HND KTFL+W NEEDHLRIISMQ GGDL
Sbjct  180  KLIDDHFLFKEGDRFLQAANACRYWPVGRGIFHNDKKTFLMWVNEEDHLRIISMQKGGDL 239
Query  240  GQVYRRLVTAVNDIEKRVPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEE 299
             +V+ RLV AV  IE+++PFS DDRLG+LTFCPTNLGTT+RASV IK+PKLAAD+KKLEE
Sbjct  240  KEVFGRLVKAVKHIEQKIPFSRDDRLGYLTFCPTNLGTTIRASVHIKLPKLAADRKKLEE 299
Query  300  VAGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            VA +YNLQVRGT GEHTE+ GG+YDISNKRRMGLTEY AVK M DGI ELIK+E SL
Sbjct  300  VAARYNLQVRGTAGEHTESVGGIYDISNKRRMGLTEYQAVKEMQDGIIELIKMEKSL 356

Sequence Alignment: 12. Allergen Name: Pan h 7.0101 Sequence ID: XP_026780620

 Score = 221.1 bits 942,  Expect = 6e-59
 Identities = 153/327 46%, Positives = 219/327 66%, Gaps = 15/327 4%
Query  26   LRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLEN--HD--SGVGIYAPDAEAYTVFADL 81
            + K L K++++ L+ K TP+ G TL D IQ+G++N  H     VG  A D E Y VF DL
Sbjct  29   MSKALNKDIYNKLRGKSTPS-GFTLDDCIQTGVDNPGHPFIMTVGCVAGDEECYEVFKDL 87
Query  82   FDPIIEDYHGGFKKTDKHPPK-DWGDVDTLGNLDPAGEYIISTRVRCGRSMQGYPFNPCL 140
            FDPII D HGG+K TDKH    +W ++    +LDP   Y++S+RVR GRS++GY + P  
Sbjct  88   FDPIISDRHGGYKPTDKHHTDLNWENLKGGDDLDP--NYVLSSRVRTGRSIKGYTLPPHN 145
Query  141  TEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQKLIDDHFLF-KEGDRFLQHAN 199
            +  + + +E      L+ L+GE+KG++YPL  MT++ Q++LI DHFLF K    +L  A 
Sbjct  146  SRGERRAVEKLSIEALTSLDGEFKGKYYPLKDMTEKEQEQLIADHFLFDKPVSPLLLAAG 205
Query  200  ACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLGQVYRRLVTAVNDIEKRVP- 258
              R WP  RGI+HND KTFLVW NEEDHLR+ISMQ GG++ +V+RR+   +  IE+    
Sbjct  206  MARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQQGGNMKEVFRRFCVGLQRIEEIFKK 265
Query  259  ----FSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKLEEVAGKYNLQVRGTRGE 314
                F  ++ LGF+  CP+NLGT +R  V +K+PKL+    K+EE+  +  LQ RGT G 
Sbjct  266  HNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLST-HPKFEEILTRLRLQKRGTGGV 324
Query  315  HTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
             T + GGV+DISN  R+G +E + V+ + DG+  +I++E  L
Sbjct  325  DTASVGGVFDISNADRLGSSEVEQVQLVVDGVKLMIEMEKKL 366

Sequence Alignment: 13. Allergen Name: Sal s 7.01 Sequence ID: ACH70914

 Score = 215.9 bits 919,  Expect = 2e-57
 Identities = 152/342 44%, Positives = 227/342 66%, Gaps = 17/342 4%
Query  9    KLEAGFAKLAASDSKSLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLEN--HD--SG 64
            K+E  +  L   ++   + K LTK+++  L+ K+TP+ G TL DVIQ+G++N  H     
Sbjct  15   KVEEEYPDLTKHNNH--MAKVLTKDMYAKLRDKQTPS-GFTLDDVIQTGVDNPGHPFIMT 71
Query  65   VGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPPK-DWGDVDTLGNLDPAGEYIIST 123
            VG  A D E+Y +F DL+DPII D H G+K TDKH    ++ ++    +LDP   Y++S+
Sbjct  72   VGCVAGDEESYEIFKDLLDPIISDRHSGYKPTDKHKTDLNFENLKGGDDLDP--NYVLSS 129
Query  124  RVRCGRSMQGYPFNPCLTEAQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQKLID 183
            RVR GRS++GY + P  +  + + +E      L+ L+GE+KG++YPL  MT   Q++LI 
Sbjct  130  RVRTGRSIKGYTLPPHNSRGERRAVEKLSVEALNTLDGEFKGKYYPLNKMTDAEQEQLIA 189
Query  184  DHFLF-KEGDRFLQHANACRFWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLGQV 242
            DHFLF K    +L  A   R WP  RGI+HNDAK+FLVW NEEDHLR+ISM+ GG++ +V
Sbjct  190  DHFLFDKPVSPLLLGAGMARDWPDARGIWHNDAKSFLVWVNEEDHLRVISMEKGGNMKEV 249
Query  243  YRRLVTAVNDIEKRVP-----FSHDDRLGFLTFCPTNLGTTVRASVRIKVPKLAADKKKL 297
            +RR+   +  IE+        F  ++ LG++  CP+NLGT +R  V +K+PKL+    K+
Sbjct  250  FRRFCVGLKRIEETFKKHNHGFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPKLST-HPKF 308
Query  298  EEVAGKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAELIKIESSL 356
            EE+  +  LQ RGT G  T + GGV+DISN  R+G +E D V+ + DG+  ++++E  L
Sbjct  309  EEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVDQVQMVVDGVKLMVEMEKKL 367

Sequence Alignment: 14. Allergen Name: Mac r 2.0101 Sequence ID: E2JE77

 Score = 203.8 bits 866,  Expect = 9e-54
 Identities = 156/318 49%, Positives = 209/318 65%, Gaps = 20/318 6%
Query  24   SLLRKYLTKEVFDNLKTKKTPTFGSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFD 83
            SL+ K++TKE ++ L   KT T G TL   I   +E  +   GIYA D ++Y  F D+FD
Sbjct  13   SLVAKHVTKERWEKLSGHKTATSGFTLKQAIACAVEFDNQHCGIYAGDWDSYKDFKDVFD 72
Query  84   PIIEDYHGGFKKTDKHPPKDWGDVDTL-GNLDPAGEYIISTRVRCGRSMQGYPFNPCLTE 142
            PII++YHG     D     D  +V+ + GN++ A   + S R+R GRS+ G+ ++P +T+
Sbjct  73   PIIQEYHG--ISPDAVHTSDM-EVEKIKGNIN-AEVPVHSVRIRVGRSIDGFGLSPGITK 128
Query  143  AQYKEMEDKVSSTLSGLEGELKGQFYPLTGMTKEVQQKLIDDHFLFKEGDRFLQHANACR 202
             Q   +E+ + S +  L G+L G +YPLTGM ++V+Q+L+DDHFLF  GDR LQ A   R
Sbjct  129  EQRIGVENLMKSAFGKLSGDLAGNYYPLTGMDEKVRQQLVDDHFLFMSGDRNLQVAGMER 188
Query  203  FWPTGRGIYHNDAKTFLVWCNEEDHLRIISMQMGGDLGQVYRRL---VTAVND---IEKR 256
             WP GRGIYHN  KTFLVW NEED+LRIISMQMGGD+  V+ RL   + AV D    E  
Sbjct  189  DWPEGRGIYHNAEKTFLVWVNEEDQLRIISMQMGGDVRGVFERLARGIKAVGDSVKAESG 248
Query  257  VPFSHDDRLGFLTFCPTNLGTTVRASVRIKVPK-----LAADKKKLEEVAGKYNLQVRGT 311
              F  D + GF+  CPTNLGT +RASV + +P      L A KK+ EE+     +Q RGT
Sbjct  249  KDFMLDPKYGFVHSCPTNLGTGMRASVHVDLPGWTKEGLDALKKRCEEL----KVQPRGT 304
Query  312  RGEHTEAEGGVYDISNKRRMGLTEYDAVKGMNDGIAEL 349
            RGE     G  YDISNK R+G +E + V+ M DG+  L
Sbjct  305  RGESGGQTGHTYDISNKHRLGYSEVELVQCMIDGVNTL 342

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.