The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP
EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY
DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9ZWP8 Vig r 6.0101 155 978 133.7 2.2e-33
CAA54421 Bet v 1.0201 160 216 38.9 7.6e-05
Q39427 Bet v 1.0205 160 216 38.9 7.6e-05
CAA54481 Bet v 1.0202 160 214 38.7 9.1e-05
P43184 Bet v 1.0203 160 213 38.6 9.9e-05
CAB02160 Bet v 1.0113 160 212 38.4 0.00011
CAA04828.1 Bet v 1.0206 159 211 38.3 0.00012
ACF75030.1 Bet v 1.0207 150 208 37.9 0.00015
P43186 Bet v 1.0204 160 208 37.9 0.00015
CAA07329.1 Bet v 1.0118 160 207 37.8 0.00017
ABC41615.1 Bet v 1.0119 150 206 37.7 0.00017
CAB02161 Bet v 1.0114 160 206 37.7 0.00018
CAB02159 Bet v 1.0112 160 205 37.6 0.0002
CAA33887 Bet v 1.0101 160 205 37.6 0.0002
CAB02156 Bet v 1.0109 160 204 37.5 0.00021
CAA54489 Bet v 1.0107 160 202 37.2 0.00026
CAA54485 Bet v 1.0105 160 202 37.2 0.00026
CAA54487 Bet v 1.0106 160 200 37.0 0.0003
CAA54482 Bet v 1.0102 160 200 37.0 0.0003
CAA04827.1 Bet v 1.0116 159 198 36.7 0.00036
CAA96547 Bet v 1.0115 160 197 36.6 0.00039
CAA07323.1 Bet v 1.0117 160 195 36.3 0.00047
CAA54483 Bet v 1.0103 160 195 36.3 0.00047
CAA54484 Bet v 1.0104 160 194 36.2 0.00051
CAB02155 Bet v 1.0108 160 194 36.2 0.00051
CAB02157 Bet v 1.0110 160 193 36.1 0.00055
CAA96536 Mal d 1.0402 160 192 36.0 0.0006
CAA96537 Mal d 1.0403 160 190 35.7 0.00072
CAA96535 Mal d 1.0401 160 189 35.6 0.00078
CAA96534 Mal d 1.0301 159 188 35.5 0.00085
P38948 Aln g 1 159 188 35.5 0.00085
AAB24432 Aln g 1 160 188 35.5 0.00085
CAB02158 Bet v 1.0111 160 187 35.3 0.00093
P25985 Pha v 1 155 186 35.2 0.00099
CAA43637 Pha v 1 156 186 35.2 0.001
CAM31909 Act d 8.0101 157 184 35.0 0.0012
CAA96548 Cor a 1.0201 160 183 34.8 0.0013
AAK13028 Mal d 1.0303 159 182 34.7 0.0014
Q256S2 Fra a 1 160 182 34.7 0.0014
B6CQS9 Pru du 1.0101 160 182 34.7 0.0014
CAB02216 Car b 1.0301 161 182 34.7 0.0014
Q256S6 Fra a 1 160 179 34.3 0.0019
Q256S7 Fra a 1 160 179 34.3 0.0019
Q3T923 Fra a 1 160 179 34.3 0.0019
CAB02217 Car b 1.0302 161 177 34.1 0.0022
Q2I6V8 Pru p 1.0101 160 176 34.0 0.0024
AAL76932 Dau c 1.0201 154 175 33.8 0.0026
AAK13027 Mal d 1.0302 159 175 33.8 0.0026
AAO25113 Mal d 1.0304 159 174 33.7 0.0028
P38950 Car b 1 159 174 33.7 0.0028
O50001 Pru ar 1 160 173 33.6 0.0031
CAA43636 Pha v 1 155 171 33.3 0.0036
CAB02208 Car b 1.0105 160 171 33.3 0.0037
CAB02209 Car b 1.0106 160 171 33.3 0.0037
Q256S4 Fra a 1 159 170 33.2 0.004
CAA96549 Cor a 1.0301 160 170 33.2 0.004
AHC08073 Sola l 4.0101 160 169 33.1 0.0044
CAA75803 Lyc e 4.0101 178 169 33.2 0.0047
CAA50325 Cor a 1.0103 160 168 33.0 0.0048
CAA54696.1 Bet v 1.0301 160 168 33.0 0.0048
CAB02213 Car b 1.0107 160 168 33.0 0.0048
CAA50328 Cor a 1.0102 160 168 33.0 0.0048
NP_001275580 Sola l 4.0201 160 168 33.0 0.0048
AFN42528 Can s 5.0101 161 168 33.0 0.0048
APD76154 Jug r 5.0101 160 166 32.7 0.0057
AAD13683 Mal d 1.0206 159 164 32.5 0.0067
AAB01362 Mal d 1.0201 159 164 32.5 0.0067
AAD26545 Mal d 1.0202 159 164 32.5 0.0067
CAD10374 Cas s 1 160 164 32.5 0.0068
CAB02215 Car b 1.0108 160 164 32.5 0.0068
AAD26553 Mal d 1.0105 159 163 32.3 0.0073
AAK13029 Mal d 1.0109 159 163 32.3 0.0073
CAA58646 Mal d 1.0101 159 163 32.3 0.0073
AAD26554 Mal d 1.0106 159 163 32.3 0.0073
AAD29671 Mal d 1.0108 159 163 32.3 0.0073
ABZ81044 Car b 1.0113 160 163 32.4 0.0074
CAB02207 Car b 1.0104 160 163 32.4 0.0074
ABZ81042 Car b 1.0111 160 163 32.4 0.0074
CAD32318 Mal d 1.0208 158 162 32.2 0.008
Q08407 Cor a 1 159 162 32.2 0.008
AAD26548 Mal d 1.0204 159 162 32.2 0.008
CAB02206 Car b 1.0103 160 162 32.2 0.008
CAA50327 Cor a 1.0101 160 162 32.2 0.008
ABZ81043 Car b 1.0112 160 162 32.2 0.008
AAD26546 Mal d 1.0103 159 161 32.1 0.0087
ABZ81041 Car b 1.0110 160 161 32.1 0.0088
AAD26558 Mal d 1.0205 159 160 32.0 0.0095
O65200 Pyr c 1 159 160 32.0 0.0095
O24248 Pru av 1 160 160 32.0 0.0095
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 133.7 bits 978,  Expect = 2e-33
 Identities = 155/155 100%, Positives = 155/155 100%, Gaps = 0/155 0%
Query  1    MVKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            MVKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP
Sbjct  1    MVKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
Query  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
            EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY
Sbjct  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
Query  121  DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
            DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA
Sbjct  121  DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155

Sequence Alignment: 2. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 38.9 bits 216,  Expect = 8e-05
 Identities = 50/143 34%, Positives = 73/143 51%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI    T++PKV P+ +  V+ IEG+GG GTI    F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    +IEGG L   L       K+    +  +++ +   
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150
            Y    D E K    K   +     LR +E YL
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYL 152

Sequence Alignment: 3. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 38.9 bits 216,  Expect = 8e-05
 Identities = 50/143 34%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     ++PKV P+ +  V+ IEG+GG GTI    F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    +IEGG L   L       KL    +  +++ +   
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150
            Y    D E K    K   +     LR +E YL
Sbjct  121  YHTKGDHEMKAEHMKAIKEKAEALLRAVESYL 152

Sequence Alignment: 4. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 38.7 bits 214,  Expect = 9e-05
 Identities = 49/143 34%, Positives = 73/143 51%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN ++E +  + A  A L K FI    T++PKV P+ +  V+ IEG+GG GTI    F P
Sbjct  4    FNYESETTSVIPA--ARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    +IEGG L   L       K+    +  +++ +   
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150
            Y    D E K    K   +     LR +E YL
Sbjct  121  YHTKGDQEMKAEHMKAIKEKGEALLRAVESYL 152

Sequence Alignment: 5. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 38.6 bits 213,  Expect = 0.0001
 Identities = 49/143 34%, Positives = 73/143 51%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN ++E +  + A  A L K FI    T++PKV P+ +  V+ IEG+GG GTI    F P
Sbjct  4    FNYESETTSVIPA--ARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    +IEGG L   L       K+    +  +++ +   
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150
            Y    D E K    K   +     LR +E YL
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYL 152

Sequence Alignment: 6. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 38.4 bits 212,  Expect = 0.0001
 Identities = 49/143 34%, Positives = 73/143 51%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     +VPKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +  +++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    D E K    K S+      LR +E YL
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 7. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 38.3 bits 211,  Expect = 0.0001
 Identities = 49/143 34%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN ++E +  + A  A L K FI     ++PKV P+ +  V+ IEG+GG GTI    F P
Sbjct  3    FNYESETTSVIPA--ARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITF-P 59
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    +IEGG L   L       KL    +  +++ +   
Sbjct  60   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNK 119
Query  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150
            Y    D E K    K   +     LR +E YL
Sbjct  120  YHTKGDHEMKAEHMKAIKEKGETLLRAVESYL 151

Sequence Alignment: 8. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 37.9 bits 208,  Expect = 0.0001
 Identities = 48/143 33%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN ++E +  + A  A L K FI     ++PKV P+ +  V+ IEG+GG GTI    F P
Sbjct  1    FNYESETTSVIPA--ARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITF-P 57
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    +IEGG L   L       K+    +  +++ +   
Sbjct  58   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 117
Query  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150
            Y    D E K    K   +     LR +E YL
Sbjct  118  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYL 149

Sequence Alignment: 9. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 37.9 bits 208,  Expect = 0.0002
 Identities = 48/143 33%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN ++E +  + A  A L K FI     ++PKV P+ +  V+ IEG+GG GTI    F P
Sbjct  4    FNYESETTSVIPA--ARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    +IEGG L   L       K+    +  +++ +   
Sbjct  61   EGSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150
            Y    D E K    K   +     LR +E YL
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYL 152

Sequence Alignment: 10. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 37.8 bits 207,  Expect = 0.0002
 Identities = 48/143 33%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     ++PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       KL    +  +++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNK 120
Query  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150
            Y    D E K    K   +     LR +E YL
Sbjct  121  YHTKGDHEMKAEHMKAIKEKGEALLRAVESYL 152

Sequence Alignment: 11. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 37.7 bits 206,  Expect = 0.0002
 Identities = 49/143 34%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  VQ IEG+GG GTI   NF P
Sbjct  1    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINF-P 57
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +   ++ +   
Sbjct  58   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNK 117
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    + E K    K S+      LR +E YL
Sbjct  118  YHTKGNHEVKAEQVKASKEMGETLLRAVESYL 149

Sequence Alignment: 12. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 37.7 bits 206,  Expect = 0.0002
 Identities = 50/141 35%, Positives = 76/141 53%, Gaps = 13/141 9%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +  +++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YDHDSDIE---EKVTPTKTSQSTLMYLRRLERYL 150
            Y    D E   E+V  +K  + TL  LR +E YL
Sbjct  121  YHTKGDHEVKAEQVKASKEMRETL--LRAVESYL 152

Sequence Alignment: 13. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 37.6 bits 205,  Expect = 0.0002
 Identities = 48/143 33%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +  +++ +   
Sbjct  61   EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    D E K    K S+      LR +E YL
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 14. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 37.6 bits 205,  Expect = 0.0002
 Identities = 48/143 33%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +  +++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    D E K    K S+      LR +E YL
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 15. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 37.5 bits 204,  Expect = 0.0002
 Identities = 48/143 33%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +  +++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    D E K    K S+      LR +E YL
Sbjct  121  YHTKGDHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 16. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 37.2 bits 202,  Expect = 0.0003
 Identities = 48/143 33%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A + K FI     +VPKV P+ +  V+ IEG+GG GTI   NF P
Sbjct  4    FNYETEATSVIPA--ARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +   ++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    + E K    K S+      LR +E YL
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 17. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 37.2 bits 202,  Expect = 0.0003
 Identities = 47/143 32%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN ++E +  + A  A L K FI     ++PKV P+ +  V+ IEG+GG GTI   NF P
Sbjct  4    FNYESETTSVIPA--ARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +   ++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    + E K    K S+      LR +E YL
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 18. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 37.0 bits 200,  Expect = 0.0003
 Identities = 48/143 33%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETEATSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+       +++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    D E K    K S+      LR +E YL
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYL 152

Sequence Alignment: 19. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 37.0 bits 200,  Expect = 0.0003
 Identities = 48/143 33%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E +  + A  A L K FI     +VPKV P+ +  V+ IEG+GG GTI   NF P
Sbjct  4    FNYEIETTSVIPA--ARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +   ++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    + E K    K S+      LR +E YL
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 20. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 36.7 bits 198,  Expect = 0.0004
 Identities = 47/143 32%, Positives = 72/143 50%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  3    FNYETEATSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 59
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    +IEGG +   L       K+    +  +++ +   
Sbjct  60   EGIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNK 119
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    D E K    K S+      LR +E YL
Sbjct  120  YHTKGDHEVKAEQVKASKEMGETLLRAVESYL 151

Sequence Alignment: 21. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 36.6 bits 197,  Expect = 0.0004
 Identities = 47/143 32%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E    + +    VIEGG +   L       K+    + ++++ +   
Sbjct  61   EGFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    D E K    K S+      LR +E YL
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYL 152

Sequence Alignment: 22. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 36.3 bits 195,  Expect = 0.0005
 Identities = 47/143 32%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +   ++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    + E K    K S+      LR +E YL
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 23. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 36.3 bits 195,  Expect = 0.0005
 Identities = 48/143 33%, Positives = 70/143 48%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETEATSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y +  + E D ++ +    VIEGG +   L       K+       +++ +   
Sbjct  61   EGIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    D E K    K S+      LR +E YL
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYL 152

Sequence Alignment: 24. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 36.2 bits 194,  Expect = 0.0005
 Identities = 47/143 32%, Positives = 70/143 48%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYEIEATSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+       +++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    D E K    K S+      LR +E YL
Sbjct  121  YHTKGDHEVKAEQIKASKEMGETLLRAVESYL 152

Sequence Alignment: 25. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 36.2 bits 194,  Expect = 0.0005
 Identities = 47/143 32%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +   ++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    + E K    K S+      LR +E YL
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 26. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 36.1 bits 193,  Expect = 0.0006
 Identities = 47/143 32%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F P
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E  P  Y ++ + E D ++ +    VIEGG +   L       K+    +   ++ +   
Sbjct  61   EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
            Y    + E K    K S+      LR +E YL
Sbjct  121  YHTKGNHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 27. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 36.0 bits 192,  Expect = 0.0006
 Identities = 44/144 30%, Positives = 69/144 47%, Gaps = 7/144 4%
Query  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            FN +TE++  + A  L+  +  D   ++PK+ P+ +K  ++IEGDGGVGTI    F    
Sbjct  4    FNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFGEGS 63
Query  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
               Y ++ +   D+ +      +IEG  L+  L       KL    +  +++     Y  
Sbjct  64   QYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSHYHA 123
Query  123  DSDIE---EKVTPTKTSQSTLMYLRRLERYL 150
              D+E   E V   K   S L  L  LE YL
Sbjct  124  KGDVEIKEEHVKAGKEKASGLFKL--LEAYL 152

Sequence Alignment: 28. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 35.7 bits 190,  Expect = 0.0007
 Identities = 44/144 30%, Positives = 69/144 47%, Gaps = 7/144 4%
Query  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            FN +TE++  + A  L+  +  D   ++PK+ P+ +K  ++IEGDGGVGTI    F    
Sbjct  4    FNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGEGS 63
Query  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
               Y ++ +   D+ +      +IEG  L+  L       KL    +  +++     Y  
Sbjct  64   QYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHYRA 123
Query  123  DSDIE---EKVTPTKTSQSTLMYLRRLERYL 150
              D+E   E V   K   S L  L  LE YL
Sbjct  124  KGDVEIKEEHVKAGKEKASGLFKL--LEAYL 152

Sequence Alignment: 29. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 35.6 bits 189,  Expect = 0.0008
 Identities = 44/144 30%, Positives = 68/144 47%, Gaps = 7/144 4%
Query  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            FN +TE +  + A  L+  +  D   ++PK+ P+ +K  ++IEGDGGVGTI    F    
Sbjct  4    FNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGEGS 63
Query  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
               Y ++ +   D+ +      +IEG  L+  L       KL    +  +++     Y  
Sbjct  64   QYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHYHA 123
Query  123  DSDIE---EKVTPTKTSQSTLMYLRRLERYL 150
              D+E   E V   K   S L  L  LE YL
Sbjct  124  KGDVEIKEEHVKAGKEKASGLFKL--LEAYL 152

Sequence Alignment: 30. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 35.5 bits 188,  Expect = 0.0009
 Identities = 44/144 30%, Positives = 74/144 51%, Gaps = 6/144 4%
Query  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            FN +TE++  +    L+  +  D   ++PK+ P+ VK  +++EGDGGVGTI   NF    
Sbjct  4    FNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGS 63
Query  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
            + SY +  I   D+ +      VIEG  +++  +  K +++   +      V    S+ H
Sbjct  64   TYSYVKHRIDGVDKENFVYKYSVIEGDAISE--TIEKISYETKLVASGSGSVIKSTSHYH 121
Query  123  D-SDIEEKVTPTKTSQSTLMYLRRL-ERYL 150
              SD+E K    K  +    +L +L E YL
Sbjct  122  TKSDVEIKEEHVKAGKEKASHLFKLIENYL 151

Sequence Alignment: 31. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 35.5 bits 188,  Expect = 0.0009
 Identities = 46/143 32%, Positives = 69/143 48%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K FI     ++PKV P  V  V+ IEG+GG GTI    F P
Sbjct  3    FNYEAETPSVIPA--ARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITF-P 59
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D  + +  + VIEGG +   L       K+    +  +++ +   
Sbjct  60   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 119
Query  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150
            +    D E      K   +  +  L+ +E YL
Sbjct  120  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYL 151

Sequence Alignment: 32. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 35.5 bits 188,  Expect = 0.0009
 Identities = 46/143 32%, Positives = 69/143 48%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K FI     ++PKV P  V  V+ IEG+GG GTI    F P
Sbjct  4    FNYEAETPSVIPA--ARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D  + +  + VIEGG +   L       K+    +  +++ +   
Sbjct  61   EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKT-SQSTLMYLRRLERYL 150
            +    D E      K   +  +  L+ +E YL
Sbjct  121  FHTKGDHEINAEQIKIEKEKAVGLLKAVESYL 152

Sequence Alignment: 33. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 35.3 bits 187,  Expect = 0.0009
 Identities = 44/144 30%, Positives = 69/144 47%, Gaps = 7/144 4%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     + PKV P+ +  V+ IEG+GG GTI   +F  
Sbjct  4    FNYETETTSVIPA--ARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPG 61
Query  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
             +   Y ++ + E D ++ +    VIEGG +   L       K+    +   ++ +   Y
Sbjct  62   GLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  DHDSDIEEKVTPTKTSQST-LMYLRRLERYL 150
                + E K    K S+      LR +E YL
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYL 152

Sequence Alignment: 34. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 35.2 bits 186,  Expect = 0.001
 Identities = 43/142 30%, Positives = 74/142 52%, Gaps = 9/142 6%
Query  5    FNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP 64
            F  QT   V    L+  ++KD  T+ PK LP   K V+++EG+GG GTI   +F+ +   
Sbjct  5    FEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGET 64
Query  65   SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTF--KLSEIEEDKTLVNVKISYDH 122
             +   +I   DE++      ++ G  L +  +  K TF  KLS+     +L+ + I+Y  
Sbjct  65   KFVLHKIESIDEANLGYSYSIVGGVALPE--TAEKITFDSKLSDGPNGGSLIKLSITYHS 122
Query  123  DSDI---EEKVTPTKTSQSTLMYLRRLERYL 150
              D    E+++   K    +L  ++ +E YL
Sbjct  123  KGDAPPNEDELKAGKAKSDSL--FKAVEAYL 151

Sequence Alignment: 35. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 35.2 bits 186,  Expect = 0.001
 Identities = 43/142 30%, Positives = 74/142 52%, Gaps = 9/142 6%
Query  5    FNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP 64
            F  QT   V    L+  ++KD  T+ PK LP   K V+++EG+GG GTI   +F+ +   
Sbjct  6    FEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGET 65
Query  65   SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTF--KLSEIEEDKTLVNVKISYDH 122
             +   +I   DE++      ++ G  L +  +  K TF  KLS+     +L+ + I+Y  
Sbjct  66   KFVLHKIESIDEANLGYSYSIVGGVALPE--TAEKITFDSKLSDGPNGGSLIKLSITYHS 123
Query  123  DSDI---EEKVTPTKTSQSTLMYLRRLERYL 150
              D    E+++   K    +L  ++ +E YL
Sbjct  124  KGDAPPNEDELKAGKAKSDSL--FKAVEAYL 152

Sequence Alignment: 36. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 35.0 bits 184,  Expect = 0.001
 Identities = 40/141 28%, Positives = 72/141 51%, Gaps = 10/141 7%
Query  5    FNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP 64
            ++ +   S+  E ++  +  D  T++PK LPH +  VQ +EGDGGVGTI +  F      
Sbjct  6    YDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFGEGSVH 65
Query  65   SYQREEITEFDESSHEIGLQVIEGGYLN--QGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
               +  I  +D+ +      +IEGG L+  + +SY+    K+    +   +   +  Y  
Sbjct  66   KSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYH---IKIVATPDGGCICKNRSIYTP 122
Query  123  DSDI---EEKVTPTKTSQSTLMYLRRLERYL 150
              D    EE++   K   S +  ++++E YL
Sbjct  123  KCDAQVSEEEIKAGKERASGI--FKKVEAYL 151

Sequence Alignment: 37. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 34.8 bits 183,  Expect = 0.001
 Identities = 46/143 32%, Positives = 71/143 49%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  + A  A L K FI     ++PKV P+ V  V+ +EG+GG GTI    F  
Sbjct  4    FNYETESTSVIPA--ARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITF-S 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    VIEGG +   +       K+    +  +++ +   
Sbjct  61   EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK 120
Query  120  YDHDSDIEEKVTPTKTSQSTLMYL-RRLERYL 150
            Y    D E      K  +  +  L R +E YL
Sbjct  121  YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYL 152

Sequence Alignment: 38. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 34.7 bits 182,  Expect = 0.001
 Identities = 41/126 32%, Positives = 66/126 52%, Gaps = 6/126 4%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ VK  +++EGDGGVGTI   NF    + SY + +I   D+ +  
Sbjct  24   VLDAD--NLIPKIAPQAVKSTEILEGDGGVGTIKKINFGEGSTYSYVKHKIDGVDKDNFV 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS-DIEEKVTPTKTSQST 139
                VIEG  +++  +  K +++   +      V   IS+ H   D+E K    K  +  
Sbjct  82   YQYSVIEGDAISE--TIEKISYETKLVASGSGSVIKSISHYHTKGDVEIKEEHVKAGKEK 139
Query  140  LMYLRRL-ERYL 150
              +L +L E YL
Sbjct  140  ASHLFKLIENYL 151

Sequence Alignment: 39. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 34.7 bits 182,  Expect = 0.001
 Identities = 38/130 29%, Positives = 60/130 46%, Gaps = 3/130 2%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ VK  +++EGDGG GTI    F       Y + +I   D+ +H 
Sbjct  24   VLDAD--NLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKVNHT 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
                +IEG  L++ +       KL       T++     Y    D+E K    K  +   
Sbjct  82   YSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 141
Query  141  MYLRRL-ERYLSN 152
             +L +L E YL +
Sbjct  142  AHLFKLIEGYLKD 154

Sequence Alignment: 40. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 34.7 bits 182,  Expect = 0.001
 Identities = 38/128 29%, Positives = 63/128 49%, Gaps = 3/128 2%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D  T++PK+ P+ VK  +++EGDGGVGTI   +F      SY + +I  +D+ +  
Sbjct  24   VLEAD--TLIPKIAPQSVKSAEIVEGDGGVGTIKKISFGEGSHYSYVKHQIDGLDKDNFV 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
                ++EG  L+  +       KL    +  +++    +Y    D+E K    K  +   
Sbjct  82   YNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSNYHTKGDVEIKEEDVKAGKEKA 141
Query  141  MYLRRL-ERYL 150
              L +L E YL
Sbjct  142  TGLFKLIENYL 152

Sequence Alignment: 41. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 34.7 bits 182,  Expect = 0.001
 Identities = 45/148 30%, Positives = 73/148 49%, Gaps = 9/148 6%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E +  + A  A L K FI     ++PKV P+ V  V+ +EG+GG GTI    F  
Sbjct  4    FNYEAETTSVIPA--ARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITF-S 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    VIEGG++   +       K+    +  +++ +   
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YDHDSDIEEKVTPTKTSQSTLM-YLRRLERYLSNGSA 155
            Y    D E      K  +  +   L+ +E YL   +A
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTA 157

Sequence Alignment: 42. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 34.3 bits 179,  Expect = 0.002
 Identities = 37/130 28%, Positives = 59/130 45%, Gaps = 3/130 2%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ +K  +++EGDGG GTI    F       Y + +I   D+ +H 
Sbjct  24   VLDAD--NLIPKIAPQAIKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHT 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
                +IEG  L+  +       KL       T++     Y    D+E K    K  +   
Sbjct  82   YSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 141
Query  141  MYLRRL-ERYLSN 152
             +L +L E YL +
Sbjct  142  SHLFKLIEGYLKD 154

Sequence Alignment: 43. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 34.3 bits 179,  Expect = 0.002
 Identities = 37/130 28%, Positives = 59/130 45%, Gaps = 3/130 2%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ +K  +++EGDGG GTI    F       Y + +I   D+ +H 
Sbjct  24   VLDAD--NLIPKIAPQAIKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHT 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
                +IEG  L+  +       KL       T++     Y    D+E K    K  +   
Sbjct  82   YSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKA 141
Query  141  MYLRRL-ERYLSN 152
             +L +L E YL +
Sbjct  142  SHLFKLIEGYLKD 154

Sequence Alignment: 44. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 34.3 bits 179,  Expect = 0.002
 Identities = 38/130 29%, Positives = 59/130 45%, Gaps = 3/130 2%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ VK  +++EGDGG GTI    F       Y + +I   D+ +H 
Sbjct  24   VLDAD--NLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHT 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
                +IEG  L+  +       KL       T++     Y    D+E K    K  +   
Sbjct  82   YSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKYHTKGDVEIKEEHVKAGKEKA 141
Query  141  MYLRRL-ERYLSN 152
             +L +L E YL +
Sbjct  142  SHLFKLIEGYLKD 154

Sequence Alignment: 45. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 34.1 bits 177,  Expect = 0.002
 Identities = 45/148 30%, Positives = 72/148 48%, Gaps = 9/148 6%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E +  + A  A L K FI     ++PKV P+ V  V+ +EG+GG GTI    F  
Sbjct  4    FNYEAETTSVIPA--ARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITF-S 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    VIEGG +   +       K+    +  +++ +   
Sbjct  61   EGSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSK 120
Query  120  YDHDSDIEEKVTPTKTSQSTLM-YLRRLERYLSNGSA 155
            Y    D E      K  +  +   L+ +E YL   +A
Sbjct  121  YHTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAHTA 157

Sequence Alignment: 46. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 34.0 bits 176,  Expect = 0.002
 Identities = 41/144 28%, Positives = 65/144 45%, Gaps = 7/144 4%
Query  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            F  ++E++  +    L+  +  D   +VPK+ P+ +K  +++EGDGG GTI    F    
Sbjct  4    FTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGS 63
Query  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
               Y + +I   D+ +H     +IEG  L   L       KL       +++     Y  
Sbjct  64   QYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHT 123
Query  123  DSDIE---EKVTPTKTSQSTLMYLRRLERYL 150
              D+E   E V   K   S L  L  +E YL
Sbjct  124  KGDVEIKEEHVKAGKEKASNLFKL--IETYL 152

Sequence Alignment: 47. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 33.8 bits 175,  Expect = 0.003
 Identities = 41/146 28%, Positives = 75/146 51%, Gaps = 6/146 4%
Query  2    VKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPE 61
            V++   +   +V  E ++  +  D  TV PKVLP+++K V+++EGDGGVGT+ + ++   
Sbjct  3    VQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLGEA 62
Query  62   VSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYD 121
               +  ++++   D++        I G  L +GL      F +   +    + N  I Y+
Sbjct  63   TEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVVNQFVVVPTDGGCIVKNTTI-YN 121
Query  122  HDSDI---EEKVTPTKTSQSTLMYLRRLERYL 150
               D    E+KV    T +S L + + +E YL
Sbjct  122  TKGDAVLPEDKVKEA-TEKSALAF-KAVEAYL 151

Sequence Alignment: 48. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 33.8 bits 175,  Expect = 0.003
 Identities = 40/126 31%, Positives = 64/126 50%, Gaps = 6/126 4%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ VK  +++EGDGGVGTI   NF    + SY +  I   D+ +  
Sbjct  24   VLDAD--NLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYSYVKHRIDGVDKDNFV 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS-DIEEKVTPTKTSQST 139
                VIEG  +++  +  K +++   +      V    S+ H   D+E K    K  +  
Sbjct  82   YKYSVIEGDAISE--TIEKISYETKLVAAGSGSVIKSTSHYHTKGDVEIKEEHVKAGKEK 139
Query  140  LMYLRRL-ERYL 150
              +L +L E YL
Sbjct  140  ASHLFKLIENYL 151

Sequence Alignment: 49. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 33.7 bits 174,  Expect = 0.003
 Identities = 40/126 31%, Positives = 64/126 50%, Gaps = 6/126 4%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ VK  +++EGDGGVGTI   NF    + SY +  I   D+ +  
Sbjct  24   VLDAD--NLIPKIAPQAVKSAEILEGDGGVGTIKKINFGEGSTYSYVKHRIDGVDKENFV 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS-DIEEKVTPTKTSQST 139
                VIEG  +++  +  K +++   +      V    S+ H   D+E K    K  +  
Sbjct  82   YKYSVIEGDAISE--TIEKISYETKLVASGSGSVIKSTSHYHTKGDVEIKEEHVKAGKEK 139
Query  140  LMYLRRL-ERYL 150
              +L +L E YL
Sbjct  140  ASHLFKLIENYL 151

Sequence Alignment: 50. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 33.7 bits 174,  Expect = 0.003
 Identities = 49/145 33%, Positives = 74/145 51%, Gaps = 15/145 10%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E +  + A  A L K FI     ++PKV P+ V  V+ +EG+GG GTI    F  
Sbjct  3    FNYEAETTSVIPA--ARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITF-S 59
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  Y +E + E D ++ +    VIEG  L   L      +K+       ++V +   
Sbjct  60   EGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 119
Query  120  YD----HDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
            +     H+ + EE +   K     L  LR +E YL   +A
Sbjct  120  FHAKGYHEVNAEE-MKGAKEMAEKL--LRAVESYLLAHTA 156

Sequence Alignment: 51. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 33.6 bits 173,  Expect = 0.003
 Identities = 41/146 28%, Positives = 66/146 45%, Gaps = 3/146 2%
Query  5    FNTQTELSVRL--EALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            F  +TE++  +  E L+  +  D   ++PKV P  VK  +++EGDGGVGTI    F    
Sbjct  4    FTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGEGS 63
Query  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
              +Y +  +   D+ +      +IEG  L+  +       KL    +  ++V     Y  
Sbjct  64   QYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHT 123
Query  123  DSDIEEKVTPTKTSQSTLMYLRRL-ERYL 150
              D+E K    K  +     L +L E YL
Sbjct  124  KGDVEIKEEQVKAGKEKAAGLFKLVEAYL 152

Sequence Alignment: 52. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 33.3 bits 171,  Expect = 0.004
 Identities = 41/143 28%, Positives = 67/143 46%, Gaps = 6/143 4%
Query  5    FNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP 64
            F  QT   V    L+  L KD  T+VPK +    K V+++EG+GG GTI   +F+ +   
Sbjct  6    FEDQTTSPVAPATLYKALVKDADTIVPKAVDSF-KSVEIVEGNGGPGTIKKISFVEDGET 64
Query  65   SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS 124
             +   +I E DE++      ++ G  L           KLS+     ++V + I Y    
Sbjct  65   KFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKG 124
Query  125  DI---EEKVTPTKTSQSTLMYLRRLERYL 150
            D    E+++   K     L  ++ +E YL
Sbjct  125  DAPPNEDELKAGKAKSDAL--FKVIEAYL 151

Sequence Alignment: 53. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 33.3 bits 171,  Expect = 0.004
 Identities = 44/143 30%, Positives = 68/143 47%, Gaps = 9/143 6%
Query  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            FN + E    + A  L+     DF  ++PKV P+ +  V+ + G+GG GTI    F  E 
Sbjct  4    FNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-AEG 62
Query  63   SP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYD 121
            SP  + +E + E D ++ +    VIEG  L   L      +K+       ++V +   + 
Sbjct  63   SPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFH 122
Query  122  HDSDIE---EKVTPTKTSQSTLMYLRRLERYL 150
               D E   EK+   K     L  LR +E YL
Sbjct  123  AKGDHEVNAEKMKGAKEMAEKL--LRAVESYL 152

Sequence Alignment: 54. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 33.3 bits 171,  Expect = 0.004
 Identities = 45/147 30%, Positives = 72/147 48%, Gaps = 11/147 7%
Query  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            FN + E    + A  L+     DF  ++PKV P+ +  V+ + G+GG GTI    F  E 
Sbjct  4    FNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-AEG 62
Query  63   SP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY- 120
            SP  + +E + E D ++ +    VIEG  L   L      +K+       ++V +   + 
Sbjct  63   SPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFH 122
Query  121  ---DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
               DH+ + EE +   K     L  LR +E YL   +A
Sbjct  123  AKGDHEVNAEE-MKGAKEMAEKL--LRAVESYLLAHTA 157

Sequence Alignment: 55. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 33.2 bits 170,  Expect = 0.004
 Identities = 38/129 29%, Positives = 59/129 45%, Gaps = 4/129 3%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ VK  +++EGDGG GTI    F       Y + +I   D+ +H 
Sbjct  24   VLDAD--NLIPKIAPQAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHT 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
                +IEG  L+  +       KL       T++     Y    D+E K    K  +   
Sbjct  82   YSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKYHTKGDVEIKEEHVKAGKEKA 140
Query  141  MYLRRL-ERYLSN 152
             +L +L E YL +
Sbjct  141  SHLFKLIEGYLKD 153

Sequence Alignment: 56. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 33.2 bits 170,  Expect = 0.004
 Identities = 46/140 32%, Positives = 78/140 55%, Gaps = 15/140 10%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN +TE +  +    A L K F+     ++PKV P  +K +++IEG+GG GTI    F  
Sbjct  4    FNYETETTSVIPP--ARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICF-D 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP +Y ++++ E D+++      VIEG  L+  L       K+       +++   IS
Sbjct  61   EGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILK-SIS 119
Query  120  YDH---DSDI-EEKVTPTKTSQSTLMYLRRLERYL 150
              H   D ++ +E++   K   S L  ++ +E YL
Sbjct  120  KYHTIGDHELKDEQIKAGKEKASGL--FKAVEGYL 152

Sequence Alignment: 57. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 33.1 bits 169,  Expect = 0.004
 Identities = 40/126 31%, Positives = 61/126 48%, Gaps = 6/126 4%
Query  2    VKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPE 61
            V  +  ++  ++    L+  L  DF  +VPK+L + VK+ + IEGDGGVG+I   NF+ E
Sbjct  3    VNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV-E 61
Query  62   VSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEED----KTLVNV 116
              P  Y + +I   D+ + E    +IEG  L + L       K+   +      KT    
Sbjct  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
Query  117  KISYDHDSDIEE 128
                DH    EE
Sbjct  122  HTKGDHVVSEEE 133

Sequence Alignment: 58. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 33.2 bits 169,  Expect = 0.005
 Identities = 40/126 31%, Positives = 61/126 48%, Gaps = 6/126 4%
Query  2    VKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPE 61
            V  +  ++  ++    L+  L  DF  +VPK+L + VK+ + IEGDGGVG+I   NF+ E
Sbjct  3    VNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFV-E 61
Query  62   VSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEED----KTLVNV 116
              P  Y + +I   D+ + E    +IEG  L + L       K+   +      KT    
Sbjct  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
Query  117  KISYDHDSDIEE 128
                DH    EE
Sbjct  122  HTKGDHVVSEEE 133

Sequence Alignment: 59. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 33.0 bits 168,  Expect = 0.005
 Identities = 44/146 30%, Positives = 71/146 48%, Gaps = 13/146 8%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E +  + A  A L K ++     ++PKV P+ +  V+ +EG+GG GTI    F  
Sbjct  4    FNYEAETTSVIPA--ARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
Query  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
                 Y +E + E D ++      VIEG  L   L      +K+       +++ +   +
Sbjct  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
Query  121  ----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
                DH+ + EE +   K     L  LR +E YL   SA
Sbjct  122  HAKGDHEINAEE-IKGAKEMAEKL--LRAVETYLLAHSA 157

Sequence Alignment: 60. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 33.0 bits 168,  Expect = 0.005
 Identities = 44/141 31%, Positives = 69/141 48%, Gaps = 13/141 9%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E +  +    A L K F+     ++PKV P  V   + IEG+GG GTI    F P
Sbjct  4    FNYEDEATSVIAP--ARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITF-P 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E S   Y +  + E D ++ +    +IEGG L   L       K+       +++ +   
Sbjct  61   EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK 120
Query  120  YDHDSDI---EEKVTPTKTSQSTLMYLRRLERYL 150
            Y    DI   EE++   K   + L  ++ +E YL
Sbjct  121  YHTKGDISLNEEEIKAGKEKGAGL--FKAVENYL 152

Sequence Alignment: 61. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 33.0 bits 168,  Expect = 0.005
 Identities = 44/147 29%, Positives = 72/147 48%, Gaps = 11/147 7%
Query  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            FN + E    + A  L+     DF  ++PKV P+ +  V+ + G+GG GTI    F  E 
Sbjct  4    FNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-AEG 62
Query  63   SP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY- 120
            SP  + +E + E D ++ +    VIEG  L   L      +K+       +++ +   + 
Sbjct  63   SPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGKFH 122
Query  121  ---DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
               DH+ + EE +   K     L  LR +E YL   +A
Sbjct  123  AKGDHEVNAEE-MKGAKEMAEKL--LRAVESYLLAHTA 157

Sequence Alignment: 62. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 33.0 bits 168,  Expect = 0.005
 Identities = 44/146 30%, Positives = 72/146 49%, Gaps = 13/146 8%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ +EG+GG GTI    F  
Sbjct  4    FNYEVETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
Query  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
                 Y +E + E D ++ +    VIEG  L   L    + +K+       +++ +   +
Sbjct  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSKF 121
Query  121  ----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
                DH+ + EE +   K     L  LR +E YL   SA
Sbjct  122  HAKGDHEINAEE-MKGAKEMAEKL--LRAVETYLLAHSA 157

Sequence Alignment: 63. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 33.0 bits 168,  Expect = 0.005
 Identities = 32/93 34%, Positives = 51/93 54%, Gaps = 2/93 2%
Query  2    VKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPE 61
            V  F  ++  ++    L+  L  DF ++VPK+L H VK ++++EGDGG G+I   NF+ E
Sbjct  3    VNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFV-E 61
Query  62   VSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGL 95
              P  Y + +I   D+ +      +IEG  L   L
Sbjct  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKL 96

Sequence Alignment: 64. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 33.0 bits 168,  Expect = 0.005
 Identities = 45/144 31%, Positives = 74/144 51%, Gaps = 12/144 8%
Query  5    FNTQTELSVRLEALWAVLSKDFI----TVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            F  ++E++  +    A L K F+     +VPK+ P+ V+ V+++EG+GGVGTI    F  
Sbjct  4    FTYESEFTSSIAP--ARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFGQ 61
Query  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTF--KLSEIEEDKTLVNVKI 118
             V   Y + +I   D+ S      +IEG  L +G    K T   KL    +   ++    
Sbjct  62   GVPFKYVKHKIEAIDKESLTYSYSIIEGDAL-EGNQLEKITHESKLVASGDGGNVIKTVS 120
Query  119  SYDH--DSDIEEKVTPTKTSQSTLMYLRRLERYLSN 152
             Y    D+ + E+       Q+T M L+ +E YL +
Sbjct  121  KYYSAGDAQVNEEKVKEGEKQATQM-LKTVEAYLKD 155

Sequence Alignment: 65. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 32.7 bits 166,  Expect = 0.006
 Identities = 43/125 34%, Positives = 63/125 50%, Gaps = 9/125 7%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PKV+P+ VK  ++IEG+GG GTI   NF       Y +      DE++  
Sbjct  24   VLDAD--NLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGEGSQYKYVKHRTDAIDEANFT 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH---DSDI-EEKVTPTKTS 136
                VIEG  L   +       K+    E  +++   IS+ H   D +I EE V   K  
Sbjct  82   YAYSVIEGDALADKIEKISYETKIVASHEGGSILK-SISHYHSKGDHEIKEEDVKDGKEK 140
Query  137  QSTLMYLRRLERYL 150
             S L  ++ +E YL
Sbjct  141  ASGL--FKAVEGYL 152

Sequence Alignment: 66. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 32.5 bits 164,  Expect = 0.007
 Identities = 37/126 29%, Positives = 61/126 48%, Gaps = 6/126 4%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ +K  +++EGDGG GTI    F       Y + +I   DE+++ 
Sbjct  24   VLDAD--NLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYS 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS-DIEEKVTPTKTSQST 139
                +IEG  L    +  K +++   +      +   IS+ H   D+E K    K  +  
Sbjct  82   YAYTLIEGDALTD--TIEKVSYETKLVASGSGSIIKSISHYHTKGDVEIKEEHVKAGKEK 139
Query  140  LMYLRRL-ERYL 150
               L +L E YL
Sbjct  140  AHGLFKLIESYL 151

Sequence Alignment: 67. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 32.5 bits 164,  Expect = 0.007
 Identities = 37/126 29%, Positives = 61/126 48%, Gaps = 6/126 4%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ +K  +++EGDGG GTI    F       Y + +I   DE+++ 
Sbjct  24   VLDAD--NLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYS 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS-DIEEKVTPTKTSQST 139
                +IEG  L    +  K +++   +      +   IS+ H   D+E K    K  +  
Sbjct  82   YAYTLIEGDALTD--TIEKVSYETKLVASGSGSIIKSISHYHTKGDVEIKEEHVKAGKEK 139
Query  140  LMYLRRL-ERYL 150
               L +L E YL
Sbjct  140  AHGLFKLIESYL 151

Sequence Alignment: 68. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 32.5 bits 164,  Expect = 0.007
 Identities = 37/126 29%, Positives = 61/126 48%, Gaps = 6/126 4%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ +K  +++EGDGG GTI    F       Y + +I   DE+++ 
Sbjct  24   VLDAD--NLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYS 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS-DIEEKVTPTKTSQST 139
                +IEG  L    +  K +++   +      +   IS+ H   D+E K    K  +  
Sbjct  82   YAYTLIEGDALTD--TIEKVSYETKLVASGSGSIIKSISHYHTKGDVEIKEEHVKAGKEK 139
Query  140  LMYLRRL-ERYL 150
               L +L E YL
Sbjct  140  AHGLFKLIESYL 151

Sequence Alignment: 69. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 32.5 bits 164,  Expect = 0.007
 Identities = 39/126 30%, Positives = 63/126 50%, Gaps = 7/126 5%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ PH +K  ++IEG+GG GTI    F       Y +  I E D+++  
Sbjct  24   VLDAD--NLIPKLAPHAIKSAEIIEGNGGPGTIKKITFGEGSQFKYVKHRIDEIDQANFT 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH--DSDI-EEKVTPTKTSQ 137
                VIEG  +N+ L       K+    +  +++     Y    + +I EEKV   K   
Sbjct  82   YCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSKYHTKGEQEIKEEKVMAGKEKA 141
Query  138  STLMYLRRLERYL 150
            + L  ++ +E YL
Sbjct  142  AGL--FKAVEAYL 152

Sequence Alignment: 70. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 32.5 bits 164,  Expect = 0.007
 Identities = 48/145 33%, Positives = 75/145 51%, Gaps = 15/145 10%
Query  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            FN + E    + A  L+     DF  ++PKV P+ +  V+ + G+GG GTI    F  E 
Sbjct  4    FNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-AEG 62
Query  63   SP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY- 120
            SP  + +E + E D ++ +    VIEG  L   L   K +++L+ +        +KIS  
Sbjct  63   SPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLE--KVSLELTIVAAPGGGSILKISGK 120
Query  121  -----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
                 DH+ + EE +   K     L  LR +E YL   +A
Sbjct  121  FHAKGDHEVNAEE-MKGAKEMAEKL--LRAVESYLLAHTA 157

Sequence Alignment: 71. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 32.3 bits 163,  Expect = 0.007
 Identities = 41/144 28%, Positives = 67/144 46%, Gaps = 6/144 4%
Query  4    EFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVS 63
            EF ++   S  ++A+  VL  D   ++PK+ P+ +K  +++EG+GG GTI    F     
Sbjct  9    EFTSEIPPSRLFKAF--VLDAD--NLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQ 64
Query  64   PSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHD 123
              Y +  I   DE+S+     +IEG  L   +       KL       T+ ++   Y   
Sbjct  65   YGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-HYHTK 123
Query  124  SDIEEKVTPTKTSQSTLMYLRRL-ERYLSN 152
             +IE K    K  +     L +L E YL +
Sbjct  124  GNIEIKEEHVKAGKEKAHGLFKLIESYLKD 153

Sequence Alignment: 72. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 32.3 bits 163,  Expect = 0.007
 Identities = 41/144 28%, Positives = 67/144 46%, Gaps = 6/144 4%
Query  4    EFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVS 63
            EF ++   S  ++A+  VL  D   ++PK+ P+ +K  +++EG+GG GTI    F     
Sbjct  9    EFTSEIPPSRLFKAF--VLDAD--NLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQ 64
Query  64   PSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHD 123
              Y +  I   DE+S+     +IEG  L   +       KL       T+ ++   Y   
Sbjct  65   YGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-HYHTK 123
Query  124  SDIEEKVTPTKTSQSTLMYLRRL-ERYLSN 152
             +IE K    K  +     L +L E YL +
Sbjct  124  GNIEIKEEHVKVGKEKAHGLFKLIESYLKD 153

Sequence Alignment: 73. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 32.3 bits 163,  Expect = 0.007
 Identities = 41/144 28%, Positives = 67/144 46%, Gaps = 6/144 4%
Query  4    EFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVS 63
            EF ++   S  ++A+  VL  D   ++PK+ P+ +K  +++EG+GG GTI    F     
Sbjct  9    EFTSEIPPSRLFKAF--VLDAD--NLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQ 64
Query  64   PSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHD 123
              Y +  I   DE+S+     +IEG  L   +       KL       T+ ++   Y   
Sbjct  65   YGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-HYHTK 123
Query  124  SDIEEKVTPTKTSQSTLMYLRRL-ERYLSN 152
             +IE K    K  +     L +L E YL +
Sbjct  124  GNIEIKEEHVKVGKEKAHGLFKLIESYLKD 153

Sequence Alignment: 74. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 32.3 bits 163,  Expect = 0.007
 Identities = 41/144 28%, Positives = 67/144 46%, Gaps = 6/144 4%
Query  4    EFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVS 63
            EF ++   S  ++A+  VL  D   ++PK+ P+ +K  +++EG+GG GTI    F     
Sbjct  9    EFTSEIPPSRLFKAF--VLDAD--NLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQ 64
Query  64   PSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHD 123
              Y +  I   DE+S+     +IEG  L   +       KL       T+ ++   Y   
Sbjct  65   YGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLVACGSGSTIKSIS-HYHTK 123
Query  124  SDIEEKVTPTKTSQSTLMYLRRL-ERYLSN 152
             +IE K    K  +     L +L E YL +
Sbjct  124  GNIEIKEEHVKAGKEKAHGLFKLIESYLKD 153

Sequence Alignment: 75. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 32.3 bits 163,  Expect = 0.007
 Identities = 41/144 28%, Positives = 67/144 46%, Gaps = 6/144 4%
Query  4    EFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVS 63
            EF ++   S  ++A+  VL  D   ++PK+ P+ +K  +++EG+GG GTI    F     
Sbjct  9    EFTSEIPPSRLFKAF--VLDAD--NLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQ 64
Query  64   PSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHD 123
              Y +  I   DE+S+     +IEG  L   +       KL       T+ ++   Y   
Sbjct  65   YGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-HYHTK 123
Query  124  SDIEEKVTPTKTSQSTLMYLRRL-ERYLSN 152
             +IE K    K  +     L +L E YL +
Sbjct  124  GNIEIKEEHVKAGKEKAHGLFKLIESYLKD 153

Sequence Alignment: 76. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 32.4 bits 163,  Expect = 0.007
 Identities = 42/146 28%, Positives = 71/146 48%, Gaps = 13/146 8%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ + G+GG GTI    F  
Sbjct  4    FNYEAETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
             +   + +E + E D ++ +    VIEG  L   L      +K+       ++V +   +
Sbjct  62   GIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  ----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
                DH+ + EE +   K     L  LR +E YL   +A
Sbjct  122  HAKGDHEVNAEE-MKGAKEMAEKL--LRAVESYLLAHTA 157

Sequence Alignment: 77. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 32.4 bits 163,  Expect = 0.007
 Identities = 44/140 31%, Positives = 71/140 50%, Gaps = 15/140 10%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ + G+GG GTI    F  
Sbjct  4    FNYEAETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-A 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  + +E + E D ++ +    VIEG  L   L      +K+       ++V +   
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  Y----DHDSDIEEKVTPTKTSQSTLMYLRRLERYL 150
            +    DH+ + EE +   K     L  LR +E YL
Sbjct  121  FHAKGDHEVNAEE-MKGAKEMAEKL--LRAVESYL 152

Sequence Alignment: 78. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 32.4 bits 163,  Expect = 0.007
 Identities = 45/146 30%, Positives = 71/146 48%, Gaps = 13/146 8%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ + G+GG GTI    F  
Sbjct  4    FNYEAETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-A 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  + +E + E D ++ +    VIEG  L   L      +K+       ++V +   
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YDHDSDIE---EKVTPTKTSQSTLMYLRRLERYLSNGSA 155
            +    D E   EK+   K     L  LR +E YL   +A
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKL--LRAVESYLLAHTA 157

Sequence Alignment: 79. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 32.2 bits 162,  Expect = 0.008
 Identities = 39/126 30%, Positives = 63/126 50%, Gaps = 10/126 7%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ +K  +++EGDGG GTI    F       Y + +I   DE+++ 
Sbjct  23   VLDAD--NLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYS 80
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH---DSDI-EEKVTPTKTS 136
                +IEG  L   +   K +++   +      +   IS+ H   D +I EE V   K  
Sbjct  81   YAYTLIEGDALTDTIE--KVSYETKLVASGSGSIIKSISHYHTKGDVEIMEEHVKAGKEK 138
Query  137  QSTLMYLRRLERYLSN 152
               L  L  +E YL +
Sbjct  139  AHGLFKL--IESYLKD 152

Sequence Alignment: 80. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 32.2 bits 162,  Expect = 0.008
 Identities = 44/146 30%, Positives = 70/146 47%, Gaps = 13/146 8%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ +EG+GG GTI    F  
Sbjct  3    FNYEVETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
                 Y +E + E D ++      VIEG  L   L      +K+       +++ +   +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  ----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
                DH+ + EE +   K     L  LR +E YL   SA
Sbjct  121  HAKGDHEINAEE-MKGAKEMAEKL--LRAVETYLLAHSA 156

Sequence Alignment: 81. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 32.2 bits 162,  Expect = 0.008
 Identities = 37/126 29%, Positives = 61/126 48%, Gaps = 6/126 4%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ +K  +++EGDGG GTI    F       Y + +I   DE+++ 
Sbjct  24   VLDAD--NLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYS 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDS-DIEEKVTPTKTSQST 139
                +IEG  L    +  K +++   +      +   IS+ H   D+E K    K  +  
Sbjct  82   YAYTLIEGDALTD--TIEKVSYETKLMASGSGSIIKSISHYHTKGDVEIKEEHVKAGKEK 139
Query  140  LMYLRRL-ERYL 150
               L +L E YL
Sbjct  140  AHGLFKLIESYL 151

Sequence Alignment: 82. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 32.2 bits 162,  Expect = 0.008
 Identities = 44/141 31%, Positives = 69/141 48%, Gaps = 13/141 9%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ + G+GG GTI    F  
Sbjct  4    FNYEAETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-A 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  + +E + E D ++ +    VIEG  L   L      +K+       ++V +   
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  YDHDSDIE---EKVTPTKTSQSTLMYLRRLERYL 150
            +    D E   EK+   K     L  LR +E YL
Sbjct  121  FHAKGDHEVNAEKMKGAKEMAEKL--LRAVESYL 152

Sequence Alignment: 83. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 32.2 bits 162,  Expect = 0.008
 Identities = 44/146 30%, Positives = 70/146 47%, Gaps = 13/146 8%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ +EG+GG GTI    F  
Sbjct  4    FNYEVETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
Query  61   EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY 120
                 Y +E + E D ++      VIEG  L   L      +K+       +++ +   +
Sbjct  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
Query  121  ----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
                DH+ + EE +   K     L  LR +E YL   SA
Sbjct  122  HAKGDHEINAEE-MKGAKEMAEKL--LRAVETYLLAHSA 157

Sequence Alignment: 84. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 32.2 bits 162,  Expect = 0.008
 Identities = 45/145 31%, Positives = 73/145 50%, Gaps = 15/145 10%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ + G+GG GTI    F  
Sbjct  4    FNYEAETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-A 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  + +E + E D ++ +    VIEG  L   L      +K+       ++V +   
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK 120
Query  120  Y----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
            +    DH+ + EE +   K     L  LR +E YL   +A
Sbjct  121  FHAKGDHEVNAEE-MKGAKEMAEKL--LRAVESYLLAHTA 157

Sequence Alignment: 85. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 32.1 bits 161,  Expect = 0.009
 Identities = 41/142 28%, Positives = 66/142 46%, Gaps = 6/142 4%
Query  4    EFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVS 63
            EF ++   S  ++A+  VL  D   ++PK+ P+ +K  +++EG+GG GTI    F     
Sbjct  9    EFTSEIPPSRLFKAF--VLDAD--NLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQ 64
Query  64   PSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHD 123
              Y +  I   DE+S+     +IEG  L   +       KL       T+ ++   Y   
Sbjct  65   YGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSIS-HYHTK 123
Query  124  SDIEEKVTPTKTSQSTLMYLRRL-ERYL 150
             +IE K    K  +     L +L E YL
Sbjct  124  GNIEIKEEHVKAGKEKAHGLFKLIESYL 151

Sequence Alignment: 86. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 32.1 bits 161,  Expect = 0.009
 Identities = 45/145 31%, Positives = 73/145 50%, Gaps = 15/145 10%
Query  5    FNTQTELSVRLEALWAVLSKDFIT----VVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP 60
            FN + E    + A  A L K ++     ++PKV P+ +  V+ + G+GG GTI    F  
Sbjct  4    FNYEAETPSVIPA--ARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITF-A 60
Query  61   EVSP-SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKIS 119
            E SP  + +E + E D ++ +    VIEG  L   L      +K+       ++V +   
Sbjct  61   EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSK 120
Query  120  Y----DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA 155
            +    DH+ + EE +   K     L  LR +E YL   +A
Sbjct  121  FHAKGDHEVNAEE-MKGAKEMAEKL--LRAVESYLLAHTA 157

Sequence Alignment: 87. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 32.0 bits 160,  Expect = 0.01
 Identities = 39/124 31%, Positives = 62/124 50%, Gaps = 10/124 8%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ +K  +++EGDGG GTI    F       Y + +I   DE+++ 
Sbjct  24   VLDAD--NLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYS 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH---DSDI-EEKVTPTKTS 136
                +IEG  L    +  K +++   +      +   IS+ H   D +I EE V   K  
Sbjct  82   YAYTLIEGDALTD--TIEKVSYETKLVASGSGSIIKSISHYHTKGDVEIKEEHVMAGKEK 139
Query  137  QSTLMYLRRLERYL 150
               L  L  +E YL
Sbjct  140  AHGLFKL--IESYL 151

Sequence Alignment: 88. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 32.0 bits 160,  Expect = 0.01
 Identities = 37/129 28%, Positives = 58/129 44%, Gaps = 4/129 3%
Query  21   VLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSPSYQREEITEFDESSHE 80
            VL  D   ++PK+ P+ +K  +++EG+GG GTI    F       Y +  +   DE+S+ 
Sbjct  24   VLDAD--NLIPKIAPQAIKHAEILEGNGGPGTIKKITFGEGSQYGYVKHRVDSIDEASYS 81
Query  81   IGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSDIEEKVTPTKTSQSTL 140
                +IEG  L   +       KL       T+ ++   Y    DIE K    K  +   
Sbjct  82   YAYTLIEGDALTDTIEKISYEAKLVASGSGSTIKSIS-HYHTKGDIEIKEEHVKAGKEKA 140
Query  141  MYLRRL-ERYLSN 152
              L +L E YL +
Sbjct  141  HGLFKLIESYLKD 153

Sequence Alignment: 89. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 32.0 bits 160,  Expect = 0.01
 Identities = 39/144 27%, Positives = 65/144 45%, Gaps = 7/144 4%
Query  5    FNTQTELSVRLEA--LWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEV 62
            F  ++E++  +    L+  +  D   +VPK+ P+ +K  +++EGDGG GTI    F    
Sbjct  4    FTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGS 63
Query  63   SPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDH 122
               Y + +I   D+ ++     +IEG  L   L       KL       +++     Y  
Sbjct  64   QYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSHYHT 123
Query  123  DSDIE---EKVTPTKTSQSTLMYLRRLERYL 150
              ++E   E V   K   S L  L  +E YL
Sbjct  124  KGNVEIKEEHVKAGKEKASNLFKL--IETYL 152

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.