The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVKFLLLALALGVSCAQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLEC
SDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVN
VDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9QXU1 Mes a 1.0101 172 1142 277.9 1.1e-76
CAX62130 Cav p 3.0101 170 489 123.4 3.3e-30
S5ZYD3 Phod s 1.0101 151 421 107.4 1.9e-25
Q28133 Bos d 2.0101 172 393 100.7 2.3e-23
A59225 Bos d 2.0102 156 367 94.6 1.4e-21
B59225 Bos d 2.0103 156 367 94.6 1.4e-21
XP_855342 Can f 6.0101 190 300 78.7 1.1e-16
AAS77253 Fel d 4 186 296 77.7 2.1e-16
P02761 Rat n 1 181 289 76.1 6.3e-16
Q95182 Equ c 1 187 287 75.6 9.2e-16
U6C8D6 Ory c 4.0101 172 255 68.1 1.6e-13
S0BDX9 Cav p 6.0101 181 247 66.1 6.2e-13
AAA39768 Mus m 1.0102 180 246 65.9 7.2e-13
P02762 Mus m 1 180 240 64.5 1.9e-12
O18874 Can f 2 180 134 39.4 6.8e-05
P02754 Bos d 5 178 124 37.1 0.00035
CAA32835 Bos d 5 178 124 37.1 0.00035
AAA30411 Bos d 5 151 105 32.7 0.0062
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mes a 1.0101 Sequence ID: Q9QXU1

 Score = 277.9 bits 1142,  Expect = 1e-76
 Identities = 172/172 100%, Positives = 172/172 100%, Gaps = 0/172 0%
Query  1    MVKFLLLALALGVSCAQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLEC 60
            MVKFLLLALALGVSCAQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLEC
Sbjct  1    MVKFLLLALALGVSCAQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLEC 60
Query  61   SDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVN 120
            SDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVN
Sbjct  61   SDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVN 120
Query  121  VDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172
            VDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ
Sbjct  121  VDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172

Sequence Alignment: 2. Allergen Name: Cav p 3.0101 Sequence ID: CAX62130

 Score = 123.4 bits 489,  Expect = 3e-30
 Identities = 73/168 43%, Positives = 116/168 69%, Gaps = 5/168 2%
Query  2    VKFLLLALALGVSCAQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLECS 61
            ++ LLLAL +G++ A HQ L+  PSE++G+WH++ IAADN  K+ EGGPLR Y  +L C 
Sbjct  1    MQILLLALTIGLAYA-HQTLD--PSEINGQWHTISIAADNVEKIGEGGPLRGYFHNLHCY 57
Query  62   DECQTFTIKFYTKVENVCQEHRVVGRKGKDGK-YITDFSGQNYFHVVEKADDTMTFHNVN 120
            D C+   + FY K++  CQ   V+G K +D   Y+  +SG N+F V+ K +D + F+N N
Sbjct  58   DGCKNIGLTFYVKLDGNCQRFDVLGAKQEDSDVYVAQYSGTNHFEVIGKKEDAIAFYNHN 117
Query  121  VDDSGK-TNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172
             D++GK T +I+VV + +S + E++Q++++ A +  IPK+NI ++   DTC Q
Sbjct  118  TDETGKETKMIVVVARRDSLTEEEQQKLQEVAGEKGIPKDNIRYFRERDTCAQ 170

Sequence Alignment: 3. Allergen Name: Phod s 1.0101 Sequence ID: S5ZYD3

 Score = 107.4 bits 421,  Expect = 2e-25
 Identities = 60/145 41%, Positives = 95/145 65%, Gaps = 1/145 0%
Query  26   SEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLECSDECQTFTIKFYTKVENVCQEHRVV 85
            +E++GKW ++ IAADN +K+ E GPLR+YV+ L C+++C    + FY    N C +  V+
Sbjct  4    AELEGKWDTIAIAADNDAKIKEEGPLRLYVRELYCNEDCSEMEVTFYVNANNQCSKTTVI 63
Query  86   GRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVNVDDSGK-TNVILVVGKGESSSIEQK 144
            G K  DG Y T F G N F+ V    + + F + NVD +G+ TN+I+VVGK +  + EQ 
Sbjct  64   GYKQADGTYRTQFEGDNRFQPVYATPENIVFTSKNVDRAGQETNLIFVVGKSQPLTPEQH 123
Query  145  QRFEKTAEKYDIPKENIEHLVTTDTC 170
            +++ + A + +IP+ENI +++ TDTC
Sbjct  124  EKLVEFAHENNIPEENIHNVLATDTC 149

Sequence Alignment: 4. Allergen Name: Bos d 2.0101 Sequence ID: Q28133

 Score = 100.7 bits 393,  Expect = 2e-23
 Identities = 56/169 33%, Positives = 101/169 59%, Gaps = 1/169 0%
Query  2    VKFLLLALALGVSC-AQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLEC 60
            +K ++L L +G+ C AQ    E+ PS++ G+W  +Y AADNK K+ EGGPLR Y + +EC
Sbjct  1    MKAVFLTLLFGLVCTAQETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIEC 60
Query  61   SDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVN 120
             ++C++++I FY K +  C     V ++ +   Y+ +F G N + V+  +++ +  +  N
Sbjct  61   INDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYVEN 120
Query  121  VDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTC 170
             D    T +   + KG S + E+ +++++   +  +P ENIE+L+ TD C
Sbjct  121  YDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 170

Sequence Alignment: 5. Allergen Name: Bos d 2.0102 Sequence ID: A59225

 Score = 94.6 bits 367,  Expect = 1e-21
 Identities = 50/154 32%, Positives = 90/154 58%, Gaps = 0/154 0%
Query  17   QHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLECSDECQTFTIKFYTKVE 76
            Q    E+ PS++ G+W  +Y AADNK K+ EGGPLR Y + +EC ++C++++I FY K +
Sbjct  1    QETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQ 60
Query  77   NVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVNVDDSGKTNVILVVGKG 136
              C     V ++ +   Y+ +F G N + V+  +++ +  +  N D    T +   + KG
Sbjct  61   GTCLLLTEVAKRQEGYVYVLEFDGTNTLEVIHVSENMLVTYVENYDGERITKMTEGLAKG 120
Query  137  ESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTC 170
             S + E+ +++++   +  +P ENIE+L+ TD C
Sbjct  121  TSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 154

Sequence Alignment: 6. Allergen Name: Bos d 2.0103 Sequence ID: B59225

 Score = 94.6 bits 367,  Expect = 1e-21
 Identities = 50/154 32%, Positives = 90/154 58%, Gaps = 0/154 0%
Query  17   QHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLECSDECQTFTIKFYTKVE 76
            Q    E+ PS++ G+W  +Y AADNK K+ EGGPLR Y + +EC ++C++++I FY K +
Sbjct  1    QETPAEIDPSKIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQ 60
Query  77   NVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVNVDDSGKTNVILVVGKG 136
              C     V ++ +   Y+ +F G N + V+  +++ +  +  N D    T +   + KG
Sbjct  61   GTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSENMLVTYAENYDGERITKMTEGLAKG 120
Query  137  ESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTC 170
             S + E+ +++++   +  +P ENIE+L+ TD C
Sbjct  121  TSFTPEELEKYQQLNSERGVPNENIENLIKTDNC 154

Sequence Alignment: 7. Allergen Name: Can f 6.0101 Sequence ID: XP_855342

 Score = 78.7 bits 300,  Expect = 1e-16
 Identities = 59/169 34%, Positives = 98/169 57%, Gaps = 10/169 5%
Query  2    VKFLLLALALGVSCAQHQNLEVSP-----SEVDGKWHSLYIAADNKSKVSEGGPLRVYVK 56
            +K+LLL L L +  A+ +  +V       S++ G W+S+ +A+D K K+ E G +RV+VK
Sbjct  1    MKLLLLCLGLILVHAHEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVK 60
Query  57   HLEC-SDECQTFTIKFYTKVENVCQEHRVVGRKG-KDGKYITDFSGQNYFHVVEKA-DDT 113
             +E  S+    FT+  +TKV   C +  ++  K  KDG+Y     G N F ++E A +D 
Sbjct  61   DIEVLSNSSLIFTM--HTKVNGKCTKISLICNKTEKDGEYDVVHDGYNLFRIIETAYEDY 118
Query  114  MTFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172
            + FH  NV+   +  ++ + G+    S + K++F +  +  +IPKENI  L   D C Q
Sbjct  119  IIFHLNNVNQEQEFQLMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRCLQ 177

Sequence Alignment: 8. Allergen Name: Fel d 4 Sequence ID: AAS77253

 Score = 77.7 bits 296,  Expect = 2e-16
 Identities = 55/168 32%, Positives = 96/168 57%, Gaps = 8/168 4%
Query  2    VKFLLLALALGVSCA-QHQNL---EVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKH 57
            +K+LLL L L + CA + +N+    +  S++ G+W+S+ +A+D K K+ E G +RV+V+H
Sbjct  1    MKLLLLCLGLILVCAHEEENVVRSNIDISKISGEWYSILLASDVKEKIEENGSMRVFVEH 60
Query  58   LECSDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKA-DDTMTF 116
            ++  D   +++  F+TK    C E  +V  K KDG Y   + G N F +VE   D+ + +
Sbjct  61   IKALDN-SSLSFVFHTKENGKCTEIFLVADKTKDGVYTVVYDGYNVFSIVETVYDEYILL 119
Query  117  HNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172
            H +N D +    ++    +    S + K++F K  +++ I   NI  L   D C Q
Sbjct  120  HLLNFDKTRPFQLVEFYAREPDVSQKLKEKFVKYCQEHGI--VNILDLTEVDRCLQ 173

Sequence Alignment: 9. Allergen Name: Rat n 1 Sequence ID: P02761

 Score = 76.1 bits 289,  Expect = 6e-16
 Identities = 53/167 31%, Positives = 100/167 59%, Gaps = 15/167 8%
Query  2    VKFLLLALALGVS--CAQHQ-------NLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLR 52
            +K+LLL L LG++  C + +       NL+V+  +++G W S+ +A++ + K+ E G +R
Sbjct  1    MKLLLLLLCLGLTLVCGHAEEASSTRGNLDVA--KLNGDWFSIVVASNKREKIEENGSMR 58
Query  53   VYVKHLECSDECQTFTIKFYTKVENVCQEHRVVGRKG-KDGKYITDFSGQNYFHVVEKAD 111
            V+++H++  +    F  KF  K    C+E  +V  K  +DG+Y  ++ G N F +++   
Sbjct  59   VFMQHIDVLENSLGF--KFRIKENGECRELYLVAYKTPEDGEYFVEYDGGNTFTILKTDY 116
Query  112  DTMT-FHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTC 170
            D    FH +N  +     ++++ G+ +  S + K++F K  E + I ++NI  L  TD C
Sbjct  117  DRYVMFHLINFKNGETFQLMVLYGRTKDLSSDIKEKFAKLCEAHGITRDNIIDLTKTDRC 176
Query  171  NQ 172
             Q
Sbjct  177  LQ 178

Sequence Alignment: 10. Allergen Name: Equ c 1 Sequence ID: Q95182

 Score = 75.6 bits 287,  Expect = 9e-16
 Identities = 58/170 34%, Positives = 94/170 55%, Gaps = 9/170 5%
Query  2    VKFLLLALALGVSCAQHQ-NLEVSP-----SEVDGKWHSLYIAADNKSKVSEGGPLRVYV 55
            +K+LLL L L + CAQ++ N +V+      S++ G+W+S+++A+D K K+ E G +RV+V
Sbjct  1    MKLLLLCLGLILVCAQQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFV 60
Query  56   KHLECSDECQTFTIKFYTKVENVCQEHRVVGRKGK-DGKYITDFSGQNYFHVVE-KADDT 113
              +   D    +  ++ TKV   C E  +V  K + DG Y  ++ G N F + E + D+ 
Sbjct  61   DVIRALDNSSLYA-EYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEH 119
Query  114  MTFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172
            + ++ VN D      +     +    S E K+ F K  +K  I KENI  L   D C Q
Sbjct  120  IILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQ 178

Sequence Alignment: 11. Allergen Name: Ory c 4.0101 Sequence ID: U6C8D6

 Score = 68.1 bits 255,  Expect = 2e-13
 Identities = 41/150 27%, Positives = 86/150 57%, Gaps = 5/150 3%
Query  18   HQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLECSDECQTFTIKFYTKVEN 77
            H + EVS  ++ G+W+S+ +A+D++ K+ E G +RV+V+++    +  +++ KF+T V  
Sbjct  12   HSHSEVS--QISGEWYSVLLASDHREKIEENGSMRVFVEYIHVW-KNSSLSFKFHTPVNG 68
Query  78   VCQEHRVVGRKGKDGK-YITDFSGQNYFHVVEKA-DDTMTFHNVNVDDSGKTNVILVVGK 135
             C E  +     +D   Y  ++ G+N F +++   DD + FH +N ++     ++ + G+
Sbjct  69   KCTELFLTCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGR 128
Query  136  GESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTC 170
            G     + +++F +  ++  I +ENI  L   D C
Sbjct  129  GLDVRSDIREKFVQLCQERGIVEENILDLTKVDRC 163

Sequence Alignment: 12. Allergen Name: Cav p 6.0101 Sequence ID: S0BDX9

 Score = 66.1 bits 247,  Expect = 6e-13
 Identities = 50/169 29%, Positives = 84/169 49%, Gaps = 9/169 5%
Query  2    VKFLLLALALGVSCAQHQNLEV-----SPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVK 56
            +K+ LL L L + C Q +  EV        ++ G W+++  A+D +  + EGG +RV+V+
Sbjct  1    MKLQLLCLGLILLCTQGEGDEVVRGNFDAEKISGNWYTVKEASDKRETIEEGGSMRVFVE 60
Query  57   HLE-CSDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKA-DDTM 114
             +E   D   +F  KF+      C++  ++  +  +G Y  ++ G N F V E    +  
Sbjct  61   SIEPVKDSALSF--KFWAHENGECKQISLICNRVAEGVYAVEYDGYNVFRVAETDYKNYA 118
Query  115  TFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172
             F+  N    G   ++ + G+    S E K RFE    K  I + NI  + T D C Q
Sbjct  119  IFQLRNFKAEGSFQLLELYGREPDVSGEIKTRFEDFCHKNGIGEGNIIDMTTVDRCLQ 176

Sequence Alignment: 13. Allergen Name: Mus m 1.0102 Sequence ID: AAA39768

 Score = 65.9 bits 246,  Expect = 7e-13
 Identities = 47/170 27%, Positives = 93/170 54%, Gaps = 9/170 5%
Query  1    MVKFLLLALALGVSC-----AQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYV 55
            M  +LLL L L + C     A       +  +++G+WH++ +A+D + K+ + G +R+++
Sbjct  1    MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL 60
Query  56   KHLECSDECQTFTIKFYTKVENVCQEHRVVGRKG-KDGKYITDFSGQNYFHVVEKA-DDT 113
            +++   +  +++ +KF+T  +  C E  +V  K  K G+Y   + G N F + +   D+ 
Sbjct  61   EQIHVLE--KSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNF 118
Query  114  MTFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172
            +  H +N  D     ++ + G+    S + K+RF K  E++ I +ENI  L   + C Q
Sbjct  119  LMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQ 177

Sequence Alignment: 14. Allergen Name: Mus m 1 Sequence ID: P02762

 Score = 64.5 bits 240,  Expect = 2e-12
 Identities = 46/170 27%, Positives = 92/170 54%, Gaps = 9/170 5%
Query  1    MVKFLLLALALGVSC-----AQHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYV 55
            M  +LLL L L + C     A       +  +++G+WH++ +A+D + K+ + G +R+++
Sbjct  1    MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFL 60
Query  56   KHLECSDECQTFTIKFYTKVENVCQEHRVVGRKG-KDGKYITDFSGQNYFHVVEKA-DDT 113
            +++   +   ++ +KF+T  +  C E  +V  K  K G+Y   + G N F + +   D+ 
Sbjct  61   EQIHVLE--NSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNF 118
Query  114  MTFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ 172
            +  H +N  D     ++ + G+    S + K+RF +  E++ I +ENI  L   + C Q
Sbjct  119  LMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQ 177

Sequence Alignment: 15. Allergen Name: Can f 2 Sequence ID: O18874

 Score = 39.4 bits 134,  Expect = 7e-05
 Identities = 37/166 22%, Positives = 78/166 46%, Gaps = 12/166 7%
Query  2    VKFLLLALALGVSC---AQHQNLEVSPS----EVDGKWHSLYIAADNKSKVSEGGPLRVY 54
            +++LLL + L + C   AQ  N E  P     E+ G+WHS+ +A++    +   G +RV+
Sbjct  1    MQLLLLTVGLALICGLQAQEGNHE-EPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVF 59
Query  55   VKHLECSDECQTFTIKFYTKVENVCQEHRVVGRK-GKDGKYITDFSGQNYFHVVEKADDT 113
            +  +   D    +        +  C++  +   K     K+  ++ G+N +++ E    +
Sbjct  60   IHSMSAKD--GNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKS 117
Query  114  -MTFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTC 170
             + ++ +N  +   + V  ++ +  S   +    FE   E   + K+ I  L   D C
Sbjct  118  YLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRC 175

Sequence Alignment: 16. Allergen Name: Bos d 5 Sequence ID: P02754

 Score = 37.1 bits 124,  Expect = 0.0003
 Identities = 34/84 40%, Positives = 53/84 63%, Gaps = 14/84 16%
Query  2    VKFLLLALALGVSCAQHQNLEVSPS-------EVDGKWHSLYIAADNKSKV-SEGGPLRV 53
            +K LLLALAL  +C   Q L V+ +       +V G W+SL +AA + S + ++  PLRV
Sbjct  1    MKCLLLALAL--TCGA-QALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRV 57
Query  54   YVKHLECSDECQTFTIKFYTKVEN-VCQEHRVVGRKGK 90
            YV+ L+ + E     +    K EN  C + +++  K K
Sbjct  58   YVEELKPTPEGDLEIL--LQKWENGECAQKKIIAEKTK 93

Sequence Alignment: 17. Allergen Name: Bos d 5 Sequence ID: CAA32835

 Score = 37.1 bits 124,  Expect = 0.0003
 Identities = 32/85 37%, Positives = 53/85 62%, Gaps = 12/85 14%
Query  2    VKFLLLALALGVSCAQHQNLEVSPS-------EVDGKWHSLYIAADNKSKV-SEGGPLRV 53
            +K LLLALAL  +C   Q L V+ +       +V G W+SL +AA + S + ++  PLRV
Sbjct  1    MKCLLLALAL--TCGA-QALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRV 57
Query  54   YVKHLECSDECQTFTIKFYTKVENVCQEHRVVGRKGK 90
            YV+ L+ + E   + I +     + C + +++  K K
Sbjct  58   YVEELKPTPE-GDLEILLQKWENDECAQKKIIAEKTK 93

Sequence Alignment: 18. Allergen Name: Bos d 5 Sequence ID: AAA30411

 Score = 32.7 bits 105,  Expect = 0.006
 Identities = 22/62 35%, Positives = 37/62 59%, Gaps = 4/62 6%
Query  27   EVDGKWHSLYIAADNKSKV-SEGGPLRVYVKHLECSDECQTFTIKFYTKVEN-VCQEHRV 84
            +V G W+SL +AA + S + ++  PLRVYV+ L+ + E     +    K EN  C + ++
Sbjct  3    KVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEIL--LQKWENDECAQKKI 60
Query  85   VGRKGK 90
            +  K K
Sbjct  61   IAEKTK 66

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.