The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVQLNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNS
EIKFKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEEGLTVTATVN
GVTSVRFYKRQ
Sequence Info Allergen Name Length Opt Bits Score E Value
AAU11502 Tyr p 13 131 809 191.8 5.1e-51
ABL09307 Aca s 13 131 700 167.0 1.5e-43
Q9U5P1 Lep d 13 131 535 129.4 3.2e-32
Q17284 Blo t 13 135 521 126.1 3.1e-31
AAP35078 Der f 13.0101 131 505 122.5 3.7e-30
E0A8N8 Der p 13.0101 131 503 122.1 5.1e-30
Q1KS35 Pen m 13.0101 136 403 99.2 3.9e-23
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tyr p 13 Sequence ID: AAU11502

 Score = 191.8 bits 809,  Expect = 5e-51
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    MVQLNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNS 60
            MVQLNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNS
Sbjct  1    MVQLNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNS 60
Query  61   EIKFKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEEGLTVTATVN 120
            EIKFKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEEGLTVTATVN
Sbjct  61   EIKFKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEEGLTVTATVN 120
Query  121  GVTSVRFYKRQ 131
            GVTSVRFYKRQ
Sbjct  121  GVTSVRFYKRQ 131

Sequence Alignment: 2. Allergen Name: Aca s 13 Sequence ID: ABL09307

 Score = 167.0 bits 700,  Expect = 2e-43
 Identities = 112/131 85%, Positives = 122/131 93%, Gaps = 0/131 0%
Query  1    MVQLNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNS 60
            MVQ+NGSYKLEKSDNFDAFLKELG+NFVTRNLAKSA+PTVEV V+GDSYTIKT+STLKN+
Sbjct  1    MVQINGSYKLEKSDNFDAFLKELGLNFVTRNLAKSATPTVEVSVNGDSYTIKTASTLKNT 60
Query  61   EIKFKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEEGLTVTATVN 120
            EI FKLGEEFEE RADGK V+T V KE D K+VQVQ+GDK VTIVREFS+EGLTVTATVN
Sbjct  61   EISFKLGEEFEEARADGKTVKTVVNKESDTKFVQVQQGDKEVTIVREFSDEGLTVTATVN 120
Query  121  GVTSVRFYKRQ 131
            GVTSVRFYKRQ
Sbjct  121  GVTSVRFYKRQ 131

Sequence Alignment: 3. Allergen Name: Lep d 13 Sequence ID: Q9U5P1

 Score = 129.4 bits 535,  Expect = 3e-32
 Identities = 80/130 61%, Positives = 103/130 79%, Gaps = 0/130 0%
Query  1    MVQLNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNS 60
            M  + G YKL+KS+NFD FL +LGV F+ +  AK+  PT+EV VDGD+Y  ++ ST+KN+
Sbjct  1    MANIAGQYKLDKSENFDQFLDKLGVGFLVKTAAKTVKPTLEVAVDGDTYIFRSLSTFKNT 60
Query  61   EIKFKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEEGLTVTATVN 120
            EIKFKLGEEFEEDRADGK+V+T + K+GDNK+VQ Q GDK V +VREF  + + VTA+V+
Sbjct  61   EIKFKLGEEFEEDRADGKRVKTVIVKDGDNKFVQTQYGDKEVKVVREFKGDEVEVTASVD 120
Query  121  GVTSVRFYKR 130
            GVTSVR YKR
Sbjct  121  GVTSVRPYKR 130

Sequence Alignment: 4. Allergen Name: Blo t 13 Sequence ID: Q17284

 Score = 126.1 bits 521,  Expect = 3e-31
 Identities = 83/127 65%, Positives = 101/127 79%, Gaps = 5/127 3%
Query  4    LNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNSEIK 63
            + G YKLEKSDNFD FL ELGV F+ +  AK+  PT+EV V GD+Y  ++ ST+KN+EIK
Sbjct  3    IEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTEIK 62
Query  64   FKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEE-----GLTVTAT 118
            FKLGEEFEEDRADGK+V+T V KEGDNK++Q Q GDK V IVR+FSE+      + VTA+
Sbjct  63   FKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFSEQIDQGDDVVVTAS 122
Query  119  VNGVTSVRFYKR 130
            V  VTSVR YKR
Sbjct  123  VGDVTSVRTYKR 134

Sequence Alignment: 5. Allergen Name: Der f 13.0101 Sequence ID: AAP35078

 Score = 122.5 bits 505,  Expect = 4e-30
 Identities = 76/130 58%, Positives = 98/130 75%, Gaps = 0/130 0%
Query  1    MVQLNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNS 60
            M  + G YKLEKS+ FD FL +LGV F+ +  AK+  PT EV ++ D Y  ++ ST+KN+
Sbjct  1    MASIEGKYKLEKSEKFDEFLDKLGVGFMVKTAAKTLKPTFEVAIENDQYIFRSLSTFKNT 60
Query  61   EIKFKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEEGLTVTATVN 120
            E KFKLGEEFEEDRADGK+V+T + KEGDNK+VQ Q GDK V I+REF+ + + VTA+ +
Sbjct  61   EAKFKLGEEFEEDRADGKRVKTVIQKEGDNKFVQTQFGDKEVKIIREFNGDEVVVTASCD 120
Query  121  GVTSVRFYKR 130
            GVTSVR YKR
Sbjct  121  GVTSVRTYKR 130

Sequence Alignment: 6. Allergen Name: Der p 13.0101 Sequence ID: E0A8N8

 Score = 122.1 bits 503,  Expect = 5e-30
 Identities = 77/130 59%, Positives = 98/130 75%, Gaps = 0/130 0%
Query  1    MVQLNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNS 60
            M  + G YKLEKS+ FD FL +LGV F+ +  AK+  PT EV  + D Y  ++ ST+KN+
Sbjct  1    MASIEGKYKLEKSEKFDEFLDKLGVGFMVKTAAKTLKPTFEVAKENDQYVFRSLSTFKNT 60
Query  61   EIKFKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKPVTIVREFSEEGLTVTATVN 120
            EIKFKLGEEFEEDRADGK+V+T + K+GDNK+VQ Q GDK V IVREF+ + + VTA+ +
Sbjct  61   EIKFKLGEEFEEDRADGKRVKTVINKDGDNKFVQTQFGDKEVKIVREFNGDEVVVTASCD 120
Query  121  GVTSVRFYKR 130
            GVTSVR YKR
Sbjct  121  GVTSVRTYKR 130

Sequence Alignment: 7. Allergen Name: Pen m 13.0101 Sequence ID: Q1KS35

 Score = 99.2 bits 403,  Expect = 4e-23
 Identities = 61/129 47%, Positives = 94/129 72%, Gaps = 6/129 4%
Query  1    MVQLNGSYKLEKSDNFDAFLKELGVNFVTRNLAKSASPTVEVIVDGDSYTIKTSSTLKNS 60
            M ++ G +K+E S+NFD F+K LGV +V R +  +A+PTVE+  DGD+Y +KT++T+K +
Sbjct  1    MAKIEGKFKMESSENFDEFMKALGVGLVMRKMGNAATPTVEITKDGDTYAMKTTTTFKTT 60
Query  61   EIKFKLGEEFEEDRADGKKVQTSVTKEGDNKLVQVQKGDKP-----VTIVREFSEEGLTV 115
            EIKFKLGEEFEE  ADG+ V++++T +G NKLV+ Q GDK        ++REF+++ + +
Sbjct  61   EIKFKLGEEFEETTADGRVVKSTITLDG-NKLVHKQVGDKEKKEKDSELLREFTDDKMLM 119
Query  116  TATVNGVTSVRFYKR 130
               V+ +   R Y R
Sbjct  120  ECKVDDIVCKRVYSR 134

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.