The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK
LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER
PQIRVPPPAPEKA
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA54587 Par j 1.0101 133 945 217.9 7.4e-59
P43217 Par j 1 139 945 217.9 7.7e-59
CAI94601 Par j 1.0103 139 941 217.0 1.4e-58
O04404 Par j 1 176 921 212.5 4.1e-57
Q40905 Par j 1 138 617 144.8 7.5e-37
O04403 Par j 2 133 332 81.4 9.2e-18
P55958 Par j 2 133 318 78.3 8e-17
NP_001316123 Sola l 7.0101 115 217 55.8 4e-10
A0A059SSZ0 Pun g 1.0201 120 217 55.8 4.2e-10
P82007 Hel a 3.0101 116 216 55.6 4.7e-10
A0A059STC4 Pun g 1.0101 120 214 55.1 6.7e-10
P93224 Sola l 3.0101 114 206 53.3 2.2e-09
AAB42069 Lyc e 3 114 206 53.3 2.2e-09
QIN55516 Art ca 3.0102 117 205 53.1 2.6e-09
O04004 Amb a 6 118 205 53.1 2.6e-09
P19656-1 Zea m 14.0101 120 204 52.9 3.1e-09
P19656-2 Zea m 14.0102 128 200 52.0 6.2e-09
ANC85027 Art si 3.0102 116 193 50.4 1.6e-08
ACE07187 Art v 3.0202 116 193 50.4 1.6e-08
ANC85020 Art ar 3.0102 116 193 50.4 1.6e-08
W0U0V5 Can s 3.0101 91 187 49.1 3.2e-08
ANC85025 Art la 3.0102 115 188 49.3 3.5e-08
EU564847 Art v 3.0301 117 188 49.3 3.6e-08
ANC85023 Art gm 3.0102 117 187 49.1 4.2e-08
19846220 Tri a 14.0101 90 185 48.7 4.3e-08
ANC85017 Art an 3.0101 117 185 48.7 5.7e-08
ANC85021 Art ca 3.0101 117 185 48.7 5.7e-08
AAL25839 Hev b 12 116 184 48.4 6.6e-08
ANC85022 Art gm 3.0101 117 182 48.0 9.1e-08
ANC85026 Art si 3.0101 116 181 47.8 1e-07
P85894 Mor n 3.0101 91 179 47.4 1.1e-07
EU564845 Art v 3.0201 114 180 47.5 1.2e-07
ANC85024 Art la 3.0101 116 180 47.5 1.2e-07
ANC85019 Art ar 3.0101 116 180 47.5 1.2e-07
A0AT29 Len c 3.0101 118 180 47.5 1.2e-07
P81402 Pru p 3 91 178 47.1 1.3e-07
ABX56711 Ara h 9.0101 116 178 47.1 1.7e-07
ACV04796 Api g 2 118 178 47.1 1.7e-07
ANC85018 Art an 3.0102 117 177 46.9 2e-07
CAL07989 Pla a 3.0101 118 176 46.7 2.3e-07
A0A059ST23 Pun g 1.0301 120 176 46.6 2.4e-07
CAB96876 Pru p 3 91 174 46.2 2.4e-07
ABX75045 Ara h 9.0201 92 172 45.8 3.3e-07
CAH69206 Tri tu 14.0101 115 172 45.8 4.2e-07
ABY21307 Pla or 3.0101 118 172 45.8 4.3e-07
ABU95411 Sin a 3.0101 92 169 45.1 5.2e-07
Q9M5X6 Pyr c 3 115 170 45.3 5.7e-07
A0A161AT60 Pis s 3.0101 120 170 45.3 5.9e-07
P81651 Pru ar 3 91 167 44.7 7e-07
ACN11576 Pru du 3.0101 123 168 44.9 8.3e-07
Q8VX12 Fra a 3.0101 117 167 44.6 9.2e-07
Q0Z8V0 Rub i 3.0101 117 164 44.0 1.5e-06
ADC80503 Pha v 3.0201 118 163 43.8 1.7e-06
Q9M5X8 Pru av 3 117 160 43.1 2.7e-06
AAA32970 Hor v 1 117 157 42.4 4.3e-06
Q4PLT9 Fra a 3.0102 117 157 42.4 4.3e-06
Q9M5X7 Mal d 3 115 156 42.2 4.9e-06
A0A510A9S3 Ara h 17.0101 93 152 41.3 7.2e-06
CAA42832 Hor v 1 134 154 41.7 7.9e-06
P82534 Pru d 3 91 149 40.7 1.1e-05
ADC80502 Pha v 3.0101 115 150 40.9 1.2e-05
AAK28533 Cor a 8 115 150 40.9 1.2e-05
Q4PLT6 Fra a 3.0202 117 149 40.6 1.5e-05
Q4PLU0 Fra a 3.0201 117 149 40.6 1.5e-05
XP_019446786 Lup an 3.0101 116 142 39.1 4.3e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 217.9 bits 945,  Expect = 7e-59
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
            MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK
Sbjct  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
Query  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 120
            LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER
Sbjct  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 120
Query  121  PQIRVPPPAPEKA 133
            PQIRVPPPAPEKA
Sbjct  121  PQIRVPPPAPEKA 133

Sequence Alignment: 2. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 217.9 bits 945,  Expect = 8e-59
 Identities = 133/133 100%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
            MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK
Sbjct  7    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 66
Query  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 120
            LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER
Sbjct  67   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 126
Query  121  PQIRVPPPAPEKA 133
            PQIRVPPPAPEKA
Sbjct  127  PQIRVPPPAPEKA 139

Sequence Alignment: 3. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 217.0 bits 941,  Expect = 1e-58
 Identities = 132/133 99%, Positives = 133/133 100%, Gaps = 0/133 0%
Query  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
            MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK
Sbjct  7    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 66
Query  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 120
            LVSEVPKHCGIVDSKLPPIDVNMDCKT+GVVPRQPQLPVSLRHGPVTGPSDPAHKARLER
Sbjct  67   LVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 126
Query  121  PQIRVPPPAPEKA 133
            PQIRVPPPAPEKA
Sbjct  127  PQIRVPPPAPEKA 139

Sequence Alignment: 4. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 212.5 bits 921,  Expect = 4e-57
 Identities = 130/133 97%, Positives = 132/133 99%, Gaps = 0/133 0%
Query  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
            +VRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTG QRVHACECIQTAMKTYSDIDGK
Sbjct  44   VVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDIDGK 103
Query  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 120
            LVSEVPKHCGIVDSKLPPIDVNMDCKT+GVVPRQPQLPVSLRHGPVTGPSDPAHKARLER
Sbjct  104  LVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER 163
Query  121  PQIRVPPPAPEKA 133
            PQIRVPPPAPEKA
Sbjct  164  PQIRVPPPAPEKA 176

Sequence Alignment: 5. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 144.8 bits 617,  Expect = 7e-37
 Identities = 87/91 95%, Positives = 90/91 98%, Gaps = 0/91 0%
Query  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
            +V ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK
Sbjct  43   VVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 102
Query  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVV 91
            LVSEVPKHCGIVDSKLPPIDVNMDCKT+GV+
Sbjct  103  LVSEVPKHCGIVDSKLPPIDVNMDCKTLGVL 133

Sequence Alignment: 6. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 81.4 bits 332,  Expect = 9e-18
 Identities = 47/87 54%, Positives = 59/87 67%, Gaps = 1/87 1%
Query  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
            +V  +MPCL FV+G+EKEPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +
Sbjct  38   VVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNE 97
Query  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTV 88
            LV+EVPK CGI  + LPPI  + DC  +
Sbjct  98   LVAEVPKKCGITTT-LPPITADFDCSKI 124

Sequence Alignment: 7. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 78.3 bits 318,  Expect = 8e-17
 Identities = 46/87 52%, Positives = 59/87 67%, Gaps = 1/87 1%
Query  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
            +V+ +MPCL FV+G+EKEPSK CCSG K+L  E KT  Q+  AC+CI  A K  S I  +
Sbjct  38   VVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNE 97
Query  61   LVSEVPKHCGIVDSKLPPIDVNMDCKTV 88
            LV+EVPK C I  + LPPI  + DC  +
Sbjct  98   LVAEVPKKCDI-KTTLPPITADFDCSKI 124

Sequence Alignment: 8. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 55.8 bits 217,  Expect = 4e-10
 Identities = 31/80 38%, Positives = 45/80 56%, Gaps = 5/80 6%
Query  5    LMPCLPFV-QGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            L PC+PF+ QG E  P   CCSG + L+G T++   R  AC C++ A   Y ++      
Sbjct  34   LAPCVPFLTQGGE--PGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQ 91
Query  64   EVPKHCGIVDSKLPPIDVNMDCKTV 88
             +P  CGI  S   PI   ++C T+
Sbjct  92   SLPSKCGI--SLTVPISRTVNCDTI 114

Sequence Alignment: 9. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 55.8 bits 217,  Expect = 4e-10
 Identities = 29/82 35%, Positives = 46/82 56%, Gaps = 4/82 4%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            +L PC+P+ +G    PS  CCSG + L+   KT P R  AC C++   ++ + I+   V 
Sbjct  37   SLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVG 96
Query  64   EVPKHCGI-VDSKLPPIDVNMDCKTV 88
             +P  CG+ +  K+ P   + DC  V
Sbjct  97   ALPGKCGVSIPYKISP---STDCSRV 119

Sequence Alignment: 10. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 55.6 bits 216,  Expect = 5e-10
 Identities = 33/80 41%, Positives = 49/80 61%, Gaps = 4/80 5%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L PCLP+++   K P+  CC+GAK+L G T+T   R  AC+C +TA      +   + S 
Sbjct  36   LTPCLPYLRSGGK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASS 93
Query  65   VPKHCGIVDSKLPPIDVNMDCKTV 88
            +P  CGI  S   PI+ N++C T+
Sbjct  94   LPGKCGISTSI--PINPNVNCNTI 115

Sequence Alignment: 11. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 55.1 bits 214,  Expect = 7e-10
 Identities = 30/82 36%, Positives = 47/82 57%, Gaps = 4/82 4%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            +L PC+P+ +         CCSG K LDG  +T P R   C+C+++A  + S I+  LV+
Sbjct  37   SLAPCIPYARSAGGAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVA 96
Query  64   EVPKHCGI-VDSKLPPIDVNMDCKTV 88
             +P  CG+ +  K+ P   + DC  V
Sbjct  97   SLPAKCGVNIPYKISP---STDCARV 119

Sequence Alignment: 12. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 53.3 bits 206,  Expect = 2e-09
 Identities = 32/79 40%, Positives = 46/79 58%, Gaps = 6/79 7%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++A  +   ID    + 
Sbjct  34   LAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAG 91
Query  65   VPKHCGI-VDSKLPPIDVNMDCKTV 88
            +P  CG+ +  K+ P   + DC TV
Sbjct  92   LPGVCGVNIPYKISP---STDCSTV 113

Sequence Alignment: 13. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 53.3 bits 206,  Expect = 2e-09
 Identities = 32/79 40%, Positives = 46/79 58%, Gaps = 6/79 7%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L PCLP+++G+   P  GCC G K L G  KT   R  AC C+++A  +   ID    + 
Sbjct  34   LAPCLPYLEGRG--PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAG 91
Query  65   VPKHCGI-VDSKLPPIDVNMDCKTV 88
            +P  CG+ +  K+ P   + DC TV
Sbjct  92   LPGVCGVNIPYKISP---STDCSTV 113

Sequence Alignment: 14. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 53.1 bits 205,  Expect = 3e-09
 Identities = 30/80 37%, Positives = 45/80 56%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            + PCL F++   + P+  CC+G K L+   KTGP R  AC C++T  K+  D+       
Sbjct  36   ITPCLSFLKQGGEVPAD-CCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVV 94
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +P  CG+    +P  I +  DC TV
Sbjct  95   LPSKCGV---NIPYKISLETDCNTV 116

Sequence Alignment: 15. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 53.1 bits 205,  Expect = 3e-09
 Identities = 32/82 39%, Positives = 45/82 54%, Gaps = 4/82 4%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L PC  F+ G+E  PSK CC+G   L+   KT   RV  C CI+   K+ +  D K +  
Sbjct  37   LAPCAGFLTGQE--PSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA-YDPKRMPL 93
Query  65   VPKHCGIVDSKLPPIDVNMDCKTVGV 90
            +   CG V   +P +D N+DC  + V
Sbjct  94   LSTKCG-VKPDFPAVDKNLDCSKLPV 118

Sequence Alignment: 16. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 52.9 bits 204,  Expect = 3e-09
 Identities = 27/82 32%, Positives = 44/82 53%, Gaps = 4/82 4%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            A+ PC+ + +G+   PS GCCSG + L+   +T   R  AC C++ A    S ++    +
Sbjct  37   AIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAA 96
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + DC  V
Sbjct  97   SIPSKCGV---SIPYTISTSTDCSRV 119

Sequence Alignment: 17. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 52.0 bits 200,  Expect = 6e-09
 Identities = 26/79 32%, Positives = 43/79 54%, Gaps = 4/79 5%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            A+ PC+ + +G+   PS GCCSG + L+   +T   R  AC C++ A    S ++    +
Sbjct  37   AIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAA 96
Query  64   EVPKHCGIVDSKLP-PIDVNMDC 85
             +P  CG+    +P  I  + DC
Sbjct  97   SIPSKCGV---SIPYTISTSTDC 116

Sequence Alignment: 18. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 50.4 bits 193,  Expect = 2e-08
 Identities = 27/80 33%, Positives = 46/80 57%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            + PCL +++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D+   + + 
Sbjct  35   ITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAAS 93
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +P  CG+    +P  I +  DC  V
Sbjct  94   LPSKCGV---NIPYKISLETDCNKV 115

Sequence Alignment: 19. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 50.4 bits 193,  Expect = 2e-08
 Identities = 27/80 33%, Positives = 46/80 57%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            + PCL +++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D+   + + 
Sbjct  35   ITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAAS 93
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +P  CG+    +P  I +  DC  V
Sbjct  94   LPSKCGV---NIPYKISLETDCNKV 115

Sequence Alignment: 20. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 50.4 bits 193,  Expect = 2e-08
 Identities = 27/80 33%, Positives = 46/80 57%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            + PCL +++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D+   + + 
Sbjct  35   ITPCLNYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAAS 93
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +P  CG+    +P  I +  DC  V
Sbjct  94   LPSKCGV---NIPYKISLETDCNKV 115

Sequence Alignment: 21. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 49.1 bits 187,  Expect = 3e-08
 Identities = 28/81 34%, Positives = 46/81 56%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            +L PCL +++     P  GCC+  K L G  KT   R  AC+C+++A  +   ++  L S
Sbjct  9    SLAPCLSYLKVGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLAS 67
Query  64   EVPKHCGI-VDSKLPPIDVNMDCKTV 88
             +P  CG+ +  K+ P   + DC +V
Sbjct  68   GLPGKCGVSIPYKISP---STDCSSV 90

Sequence Alignment: 22. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 49.3 bits 188,  Expect = 4e-08
 Identities = 28/78 35%, Positives = 43/78 55%, Gaps = 5/78 6%
Query  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
            PCL +++ K  E    CC+G K L+  TKT P R  AC C++ + K+  D+   +   +P
Sbjct  36   PCLSYLK-KGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLP 94
Query  67   KHCGIVDSKLP-PIDVNMDCKTV 88
              CG+    LP  + +  DC  V
Sbjct  95   SKCGL---NLPYKLSLETDCNKV 114

Sequence Alignment: 23. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 49.3 bits 188,  Expect = 4e-08
 Identities = 28/78 35%, Positives = 43/78 55%, Gaps = 5/78 6%
Query  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
            PCL +++ K  E    CC+G K L+  TKT P R  AC C++ + K+  D+   +   +P
Sbjct  38   PCLSYLK-KGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLP 96
Query  67   KHCGIVDSKLP-PIDVNMDCKTV 88
              CG+    LP  + +  DC  V
Sbjct  97   SKCGL---NLPYKLSLETDCNKV 116

Sequence Alignment: 24. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 49.1 bits 187,  Expect = 4e-08
 Identities = 28/78 35%, Positives = 43/78 55%, Gaps = 5/78 6%
Query  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
            PCL F++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D+       +P
Sbjct  38   PCLSFLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLP 96
Query  67   KHCGIVDSKLP-PIDVNMDCKTV 88
              CG+    +P  I +  DC  V
Sbjct  97   SKCGV---NIPYKISLETDCNKV 116

Sequence Alignment: 25. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 48.7 bits 185,  Expect = 4e-08
 Identities = 27/78 34%, Positives = 41/78 52%, Gaps = 5/78 6%
Query  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
            PCL +VQG    PS  CC G K L  + ++   R  AC C++   +   +++      +P
Sbjct  12   PCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIP 70
Query  67   KHCGIVDSKLP-PIDVNMDCKTV 88
              CG+    LP  I +N+DC  V
Sbjct  71   PKCGV---NLPYTISLNIDCSRV 90

Sequence Alignment: 26. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 48.7 bits 185,  Expect = 6e-08
 Identities = 30/79 37%, Positives = 42/79 53%, Gaps = 7/79 8%
Query  5    LMPCLPFV-QGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            ++PC  F+ QG E   S  CC+G K L+   KT P R  AC C++T  K+  D       
Sbjct  36   ILPCTSFLKQGGEV--SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAV 93
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I +  DC  V
Sbjct  94   VLPSKCGV---NIPYKISLETDCNKV 116

Sequence Alignment: 27. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 48.7 bits 185,  Expect = 6e-08
 Identities = 30/79 37%, Positives = 42/79 53%, Gaps = 7/79 8%
Query  5    LMPCLPFV-QGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            ++PC  F+ QG E   S  CC+G K L+   KT P R  AC C++T  K+  D       
Sbjct  36   ILPCTSFLKQGGEV--SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAV 93
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I +  DC  V
Sbjct  94   VLPSKCGV---NIPYKISLETDCNKV 116

Sequence Alignment: 28. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 48.4 bits 184,  Expect = 7e-08
 Identities = 25/82 30%, Positives = 47/82 57%, Gaps = 4/82 4%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            AL+PCL +++     P   CC+G + ++   KT   R  AC+C+++A  +   ++   V+
Sbjct  33   ALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVA 92
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I ++ +C TV
Sbjct  93   GLPGKCGV---NIPYKISLSTNCATV 115

Sequence Alignment: 29. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 48.0 bits 182,  Expect = 9e-08
 Identities = 27/78 34%, Positives = 42/78 53%, Gaps = 5/78 6%
Query  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
            PC  F++   + P+  CC+G K L+   KT P R  AC C++T+ K+  D      + +P
Sbjct  38   PCTSFLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLP 96
Query  67   KHCGIVDSKLP-PIDVNMDCKTV 88
              CG+    +P  I +  DC  V
Sbjct  97   SKCGV---NIPYKISLETDCNKV 116

Sequence Alignment: 30. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 47.8 bits 181,  Expect = 1e-07
 Identities = 26/78 33%, Positives = 42/78 53%, Gaps = 5/78 6%
Query  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
            PCL +++   + P+  CC+G K L+   KT P R  AC C++ + KT  D+       +P
Sbjct  37   PCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLP 95
Query  67   KHCGIVDSKLP-PIDVNMDCKTV 88
              CG+    +P  + +  DC  V
Sbjct  96   SKCGVT---IPYKLSMETDCNKV 115

Sequence Alignment: 31. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 47.4 bits 179,  Expect = 1e-07
 Identities = 26/81 32%, Positives = 47/81 58%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            +L PC+ +++     P+  CC+G + L+   KT   R  AC C+++A  +   ++  L +
Sbjct  9    SLAPCINYLRAGGVVPAN-CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAA 67
Query  64   EVPKHCGI-VDSKLPPIDVNMDCKTV 88
             +P  CG+ V  K+ P   + DCK+V
Sbjct  68   GLPGKCGVSVPYKISP---STDCKSV 90

Sequence Alignment: 32. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 47.5 bits 180,  Expect = 1e-07
 Identities = 26/77 33%, Positives = 42/77 54%, Gaps = 5/77 6%
Query  8    CLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK 67
            CL +++   + P+  CC+G K L+   KT P R  AC C++T  K+  D    + + +P 
Sbjct  36   CLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPS 94
Query  68   HCGIVDSKLP-PIDVNMDCKTV 88
             CG+    +P  I +  DC  V
Sbjct  95   KCGV---NIPYKISLETDCNKV 113

Sequence Alignment: 33. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 47.5 bits 180,  Expect = 1e-07
 Identities = 26/77 33%, Positives = 42/77 54%, Gaps = 5/77 6%
Query  8    CLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK 67
            CL +++   + P+  CC+G K L+   KT P R  AC C++T  K+  D    + + +P 
Sbjct  38   CLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPS 96
Query  68   HCGIVDSKLP-PIDVNMDCKTV 88
             CG+    +P  I +  DC  V
Sbjct  97   KCGV---NIPYKISLETDCNKV 115

Sequence Alignment: 34. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 47.5 bits 180,  Expect = 1e-07
 Identities = 26/77 33%, Positives = 42/77 54%, Gaps = 5/77 6%
Query  8    CLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK 67
            CL +++   + P+  CC+G K L+   KT P R  AC C++T  K+  D    + + +P 
Sbjct  38   CLSYLKQGGEVPAD-CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPS 96
Query  68   HCGIVDSKLP-PIDVNMDCKTV 88
             CG+    +P  I +  DC  V
Sbjct  97   KCGV---NIPYKISLETDCNKV 115

Sequence Alignment: 35. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 47.5 bits 180,  Expect = 1e-07
 Identities = 27/80 33%, Positives = 42/80 52%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L PCL ++ G    PS  CC G K+L     T P R  AC C+++A  + + ++    + 
Sbjct  36   LSPCLTYLTGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAA 94
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +P  CG+    +P  I    +C TV
Sbjct  95   LPGKCGV---NIPYKISTTTNCNTV 116

Sequence Alignment: 36. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 47.1 bits 178,  Expect = 1e-07
 Identities = 25/81 30%, Positives = 44/81 54%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            AL PC+P+V+G    P   CC+G + ++   +T P R  AC C++    +   ++    +
Sbjct  9    ALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAA 67
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + +C TV
Sbjct  68   ALPGKCGV---HIPYKISASTNCATV 90

Sequence Alignment: 37. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 47.1 bits 178,  Expect = 2e-07
 Identities = 27/81 33%, Positives = 43/81 53%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            AL PC+PF+  K   P   CCSG + L G  +T   R  AC C++ A  +   ++    +
Sbjct  33   ALAPCIPFLT-KGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAA 91
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + +C T+
Sbjct  92   ALPGRCGV---SIPYKISTSTNCATI 114

Sequence Alignment: 38. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 47.1 bits 178,  Expect = 2e-07
 Identities = 29/77 37%, Positives = 42/77 54%, Gaps = 5/77 6%
Query  8    CLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK 67
            CL +++G    PS  CC G K L+   KT   R +AC C++T   +   I+    S +P 
Sbjct  40   CLGYLKGG-GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPG 98
Query  68   HCGIVDSKLP-PIDVNMDCKTV 88
             CGI   ++P PI  + DC  V
Sbjct  99   KCGI---RIPYPISPSTDCSRV 117

Sequence Alignment: 39. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 46.9 bits 177,  Expect = 2e-07
 Identities = 27/84 32%, Positives = 46/84 54%, Gaps = 5/84 5%
Query  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
            + + + PC  F++ K  E    CC+G K L+   KT P R  AC C++T+ K+ ++   +
Sbjct  32   VTKKISPCTSFLE-KGGEVPVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEE 90
Query  61   LVSEVPKHCGIVDSKLP-PIDVNMDCKTV 88
              + +P  CG+    +P  I +  DC  V
Sbjct  91   NAAVLPSKCGV---NIPYKISLETDCNKV 116

Sequence Alignment: 40. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 46.7 bits 176,  Expect = 2e-07
 Identities = 32/83 38%, Positives = 46/83 55%, Gaps = 7/83 8%
Query  1    MVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDG 59
            +V  L PCL F++ G    P+  CC+G K L+ + KT P R  AC C++TA  + S I  
Sbjct  33   VVTRLTPCLTFLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQL 90
Query  60   KLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 88
               + +   CG+    LP  I   +DC  V
Sbjct  91   GNAASLAGKCGV---NLPYKISPTIDCSKV 117

Sequence Alignment: 41. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 46.6 bits 176,  Expect = 2e-07
 Identities = 26/82 31%, Positives = 45/82 54%, Gaps = 5/82 6%
Query  4    ALMPCLPFVQGKEKEP-SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLV 62
            +L  C+ + +G    P  + CC+G + L+   KT P R  AC C+++   + S I+  LV
Sbjct  36   SLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLV 95
Query  63   SEVPKHCGI-VDSKLPPIDVNMDCKTV 88
            +  P  CG+ +  K+ P   + +C  V
Sbjct  96   AGAPGKCGVSIPYKIAP---STNCDNV 119

Sequence Alignment: 42. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 46.2 bits 174,  Expect = 2e-07
 Identities = 24/81 29%, Positives = 44/81 54%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            +L PC+P+V+G    P   CC+G + ++   +T P R  AC C++    +   ++    +
Sbjct  9    SLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAA 67
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + +C TV
Sbjct  68   ALPGKCGV---SIPYKISASTNCATV 90

Sequence Alignment: 43. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 45.8 bits 172,  Expect = 3e-07
 Identities = 28/81 34%, Positives = 43/81 53%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            AL PC+ F+  K   PS  CCSG + L G  KT   R  AC C++ A  +   ++    +
Sbjct  9    ALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAA 67
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + +C T+
Sbjct  68   ALPGRCGV---SIPYKISTSTNCATI 90

Sequence Alignment: 44. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 45.8 bits 172,  Expect = 4e-07
 Identities = 26/79 32%, Positives = 43/79 54%, Gaps = 7/79 8%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            AL PC+ + +G    PS  CCSG + L    ++   +  AC+CI++A    +   GK   
Sbjct  35   ALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLN--AGKAAG 92
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  ++DC  +
Sbjct  93   -IPTKCGV---SVPYAISSSVDCSKI 114

Sequence Alignment: 45. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 45.8 bits 172,  Expect = 4e-07
 Identities = 31/83 37%, Positives = 46/83 55%, Gaps = 7/83 8%
Query  1    MVRALMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDG 59
            +V  L PCL +++ G    P+  CC+G K L+ + KT P R  AC C++TA  + S I  
Sbjct  33   VVTRLTPCLTYLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQL 90
Query  60   KLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 88
               + +   CG+    LP  I   +DC  V
Sbjct  91   GNAASLAGKCGV---NLPYKISPTIDCSKV 117

Sequence Alignment: 46. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 45.1 bits 169,  Expect = 5e-07
 Identities = 24/80 30%, Positives = 43/80 53%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L  C+ ++      P KGCC+G   L+   +T P R +AC C+  A  ++  ++    + 
Sbjct  11   LAACIGYLTQNAPLP-KGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAA 69
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +PK CG+    +P  I  + +C +V
Sbjct  70   LPKACGV---NIPYKISKSTNCNSV 91

Sequence Alignment: 47. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 45.3 bits 170,  Expect = 6e-07
 Identities = 26/80 32%, Positives = 42/80 52%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L PC+ +V+     P   CC+G K ++G  KT P R  AC C++    + S ++      
Sbjct  34   LAPCINYVRSGGAVPP-ACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAES 92
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +P  CG+    +P  I  + +C TV
Sbjct  93   LPGKCGV---NVPYKISTSTNCATV 114

Sequence Alignment: 48. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 45.3 bits 170,  Expect = 6e-07
 Identities = 24/81 29%, Positives = 42/81 51%, Gaps = 5/81 6%
Query  5    LMPCLPFVQGKEKE-PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            + PC+ ++Q      P   CC+G K+L     T P R  AC C+++A  +   ++    +
Sbjct  36   MAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAA 95
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + +C TV
Sbjct  96   ALPGKCGV---SIPYKISTSTNCNTV 118

Sequence Alignment: 49. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 44.7 bits 167,  Expect = 7e-07
 Identities = 24/81 29%, Positives = 44/81 54%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            +L PC+ +V+G    P   CC+G + ++   +T P R  AC C++    + S ++    +
Sbjct  9    SLAPCIGYVRGGGAVPP-ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAA 67
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + +C TV
Sbjct  68   ALPGKCGV---NIPYKISASTNCATV 90

Sequence Alignment: 50. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 44.9 bits 168,  Expect = 8e-07
 Identities = 28/83 33%, Positives = 47/83 56%, Gaps = 9/83 10%
Query  1    MVRALMPCLPFV-QGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMK--TYSDI 57
            +V  L PC+ +V  G    PS  CC+G + L    +T   R   C C++ A+    Y++ 
Sbjct  36   VVNNLTPCINYVANGGALNPS--CCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNA 93
Query  58   DGKLVSEVPKHCGI-VDSKLPPIDVNMDCKTV 88
            +  L + +P  CG+ +  K+ P   + DCKT+
Sbjct  94   NAGLAAGLPGKCGVNIPYKISP---STDCKTI 122

Sequence Alignment: 51. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 44.6 bits 167,  Expect = 9e-07
 Identities = 26/78 33%, Positives = 40/78 51%, Gaps = 5/78 6%
Query  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
            PCL +V+     P+  CCSG + L+G  KT   R  AC C++ A      ++  L + +P
Sbjct  38   PCLTYVKSGGAVPA-ACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLP 96
Query  67   KHCGIVDSKLP-PIDVNMDCKTV 88
              CG+    +P  I    +C  V
Sbjct  97   GKCGV---SVPYKISTTTNCAAV 116

Sequence Alignment: 52. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 44.0 bits 164,  Expect = 1e-06
 Identities = 23/84 27%, Positives = 46/84 54%, Gaps = 5/84 5%
Query  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK 60
            + + + PC+ +V+     P+  CC+G + L+ + KT   R + C C++ A  +   ++  
Sbjct  32   VTQNVAPCFNYVKNGGAVPA-ACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPS 90
Query  61   LVSEVPKHCGIVDSKLP-PIDVNMDCKTV 88
            L + +P  CG+    +P  I  + +C TV
Sbjct  91   LAAGLPGKCGV---SVPYKISTSTNCATV 116

Sequence Alignment: 53. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 43.8 bits 163,  Expect = 2e-06
 Identities = 24/81 29%, Positives = 40/81 49%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            +L  C+PF+      P+  CCSG + L+   KT P R   C C+++A       +     
Sbjct  35   SLASCIPFLTKGGPVPAS-CCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAG 93
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + +C T+
Sbjct  94   ILPGKCGV---SIPYKISTSTNCATI 116

Sequence Alignment: 54. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 43.1 bits 160,  Expect = 3e-06
 Identities = 24/80 30%, Positives = 42/80 52%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L PC+ +V+G    P   CC+G + ++   KT   R  AC C++    +   ++    + 
Sbjct  36   LAPCIAYVRGGGAVPP-ACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAA 94
Query  65   VPKHCGI-VDSKLPPIDVNMDCKTV 88
            +P  CG+ V  K+ P   + +C TV
Sbjct  95   LPGKCGVNVPYKISP---STNCATV 116

Sequence Alignment: 55. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 42.4 bits 157,  Expect = 4e-06
 Identities = 21/80 26%, Positives = 41/80 51%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            + PCL +VQG    PS  CC+G + L  + ++   R   C C++   +   +++    + 
Sbjct  36   MKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAAS 94
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +P  C +    +P  I  ++DC  +
Sbjct  95   IPSKCNV---NVPYTISPDIDCSRI 116

Sequence Alignment: 56. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 42.4 bits 157,  Expect = 4e-06
 Identities = 24/78 30%, Positives = 39/78 50%, Gaps = 5/78 6%
Query  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
            PC+ +V+     P+  CCSG + L+G  KT   R   C C++ A      ++  L + +P
Sbjct  38   PCVTYVKSGGAVPAP-CCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLP 96
Query  67   KHCGIVDSKLP-PIDVNMDCKTV 88
              CG+    +P  I    +C  V
Sbjct  97   GKCGV---SVPYKISTTTNCAAV 116

Sequence Alignment: 57. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 42.2 bits 156,  Expect = 5e-06
 Identities = 23/81 28%, Positives = 43/81 53%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            +L PC+ +V+     P   CC+G + ++G  +T   R  AC C++    + S ++    +
Sbjct  33   SLAPCIGYVRSGGAVPP-ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAA 91
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + +C TV
Sbjct  92   GLPGKCGV---NVPYKISTSTNCATV 114

Sequence Alignment: 58. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 41.3 bits 152,  Expect = 7e-06
 Identities = 22/84 26%, Positives = 47/84 55%, Gaps = 6/84 7%
Query  1    MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY-SDIDG 59
            + +++ PC+ +++      S  CCSG + ++G  KT   R   C C+++A  +  S I+ 
Sbjct  7    VTKSIAPCFGYLKSG-GTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINP 65
Query  60   KLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 88
               + +P  CG+    +P  I  +++C ++
Sbjct  66   NNAASLPGKCGV---SIPYKISTSINCSSI 92

Sequence Alignment: 59. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 41.7 bits 154,  Expect = 8e-06
 Identities = 21/77 27%, Positives = 40/77 51%, Gaps = 5/77 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            + PCL +VQG    PS  CC+G + L  + ++   R   C C++   +   +++    + 
Sbjct  36   MKPCLTYVQGGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAAS 94
Query  65   VPKHCGIVDSKLP-PIDVNMDC 85
            +P  C +    +P  I  ++DC
Sbjct  95   IPSKCNV---NVPYTISPDIDC 113

Sequence Alignment: 60. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 40.7 bits 149,  Expect = 1e-05
 Identities = 22/80 27%, Positives = 41/80 51%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L PC+ +V+G    P   CC+G + ++   +T   R  AC C++    +   ++    + 
Sbjct  10   LAPCINYVKGGGAVPP-ACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAA 68
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +P  CG+    +P  I  + +C TV
Sbjct  69   LPGKCGV---NVPYKISASTNCATV 90

Sequence Alignment: 61. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 40.9 bits 150,  Expect = 1e-05
 Identities = 21/80 26%, Positives = 41/80 51%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L+PC+ F+Q     P+ GCC+G + +    ++   R   C C++TA      ++      
Sbjct  34   LVPCVTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQA 92
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +P  CG+    +P  I  + +C ++
Sbjct  93   LPGKCGV---NIPYKISTSTNCASI 114

Sequence Alignment: 62. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 40.9 bits 150,  Expect = 1e-05
 Identities = 23/79 29%, Positives = 44/79 55%, Gaps = 7/79 8%
Query  5    LMPCLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            L PC+ +++ G    PS  CC G + ++  ++T   R  AC C++   K  + ++  L +
Sbjct  34   LTPCVLYLKNGGVLPPS--CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAA 91
Query  64   EVPKHCGI-VDSKLPPIDVNMDCKTV 88
             +P  CG+ +  K+ P   + +C  V
Sbjct  92   GLPGKCGVNIPYKISP---STNCNNV 114

Sequence Alignment: 63. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 40.6 bits 149,  Expect = 1e-05
 Identities = 22/81 27%, Positives = 41/81 50%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            ++ PC+ +V+     P+  CC+G + L+   KT   R   C C++ A      ++  L +
Sbjct  35   SISPCVNYVKSGGAVPA-ACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAA 93
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + +C  V
Sbjct  94   GLPGKCGV---NVPYKISTSTNCAAV 116

Sequence Alignment: 64. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 40.6 bits 149,  Expect = 1e-05
 Identities = 22/81 27%, Positives = 41/81 50%, Gaps = 5/81 6%
Query  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
            ++ PC+ +V+     P+  CC+G + L+   KT   R   C C++ A      ++  L +
Sbjct  35   SISPCVNYVKSGGAVPA-ACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAA 93
Query  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88
             +P  CG+    +P  I  + +C  V
Sbjct  94   GLPGKCGV---SVPYKISTSTNCAAV 116

Sequence Alignment: 65. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 39.1 bits 142,  Expect = 4e-05
 Identities = 22/80 27%, Positives = 39/80 48%, Gaps = 5/80 6%
Query  5    LMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSE 64
            L  CL +++     P+  CC+G K +    KT P R  AC C++ A      ++      
Sbjct  35   LAQCLNYLRSGGAVPAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGS 93
Query  65   VPKHCGIVDSKLP-PIDVNMDCKTV 88
            +P  CG+    +P  I  + +C ++
Sbjct  94   LPGKCGV---NIPYKISTSTNCASI 115

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.