The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQ
YGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVN
PDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQ
QSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKH
AKSSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGL
LLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPV
AINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQS
ESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY
Sequence Info Allergen Name Length Opt Bits Score E Value
Q198W3 Vig r 2.0101 453 2951 679.0 1.4e-196
B1NPN8 Vig r 2.0201 454 2470 569.3 1.4e-163
Q9FZP9 Gly m 5.0201 559 1971 455.5 3.1e-129
AAB23463 Gly m conglycinin 439 1917 443.3 1.2e-125
O22120 Gly m 5.0101 543 1905 440.5 1e-124
CAA35691 Gly m conglycinin 605 1905 440.5 1.1e-124
AAB01374 Gly m conglycinin 639 1447 336.1 3.2e-93
ACB05815 Lup an 1.0101 611 1220 284.3 1.2e-77
CAD87731 Len c 1.0102 415 1152 268.9 3.4e-73
CAD87730 Len c 1.0101 418 1150 268.5 4.7e-73
CAF25232 Pis s 1.0101 415 1123 262.3 3.3e-71
CAF25233 Pis s 1.0102 415 1106 258.4 4.9e-70
AAM54366 Jug n 2 481 995 233.1 2.4e-62
AAA33947 Gly m conglycinin 218 982 230.4 6.9e-62
AAF18269 Jug r 2 593 982 230.1 2.4e-61
Q9SPL3 Mac i 1.0101 625 917 215.3 7.3e-57
Q9SPL4 Mac i 1.0201 666 912 214.1 1.7e-56
B3STU4 Car i 2.0101 792 851 200.2 3.2e-52
P09801 Gos h 1 588 735 173.8 2.1e-44
P09799 Gos h 2 605 720 170.4 2.3e-43
P43237 Ara h 1 614 646 153.5 2.8e-38
P43238 Ara h 1 626 643 152.8 4.6e-38
AAK15089 Ses i 3 585 576 137.5 1.7e-33
EF116865 Pis v 3.0101 519 575 137.3 1.7e-33
A0A2I4E5L6 Jug r 6.0101 502 555 132.8 3.9e-32
V9VGU0 Pin k 2.0101 463 510 122.5 4.4e-29
AAL86739 Cor a 11 448 425 103.2 2.9e-23
AAM73729 Ana o 1.0102 536 403 98.1 1.1e-21
AAM73730 Ana o 1.0101 538 403 98.1 1.1e-21
A0A0S3B0K0 Coc n 1.0101 490 224 57.3 2e-09
BAB21619 Gly m Bd28K 473 210 54.2 1.7e-08
P13744 Cuc ma 4.0101 480 177 46.6 3.2e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 679.0 bits 2951,  Expect = 1e-196
 Identities = 453/453 100%, Positives = 453/453 100%, Gaps = 0/453 0%
Query  1    MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQ 60
            MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQ
Sbjct  1    MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQ 60
Query  61   YGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVN 120
            YGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVN
Sbjct  61   YGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVN 120
Query  121  PDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQ 180
            PDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQ
Sbjct  121  PDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQ 180
Query  181  QSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKH 240
            QSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKH
Sbjct  181  QSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKH 240
Query  241  AKSSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGL 300
            AKSSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGL
Sbjct  241  AKSSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGL 300
Query  301  LLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPV 360
            LLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPV
Sbjct  301  LLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPV 360
Query  361  AINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQS 420
            AINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQS
Sbjct  361  AINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQS 420
Query  421  ESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY 453
            ESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY
Sbjct  421  ESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY 453

Sequence Alignment: 2. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 569.3 bits 2470,  Expect = 1e-163
 Identities = 380/443 85%, Positives = 417/443 94%, Gaps = 7/443 1%
Query  1    MVRARVQLLL--GILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFK 58
            MVRAR+ LLL  GILFLASLSVSFGIVHRE+ +  E S SRG+NNPFYFNSDR FHTLF+
Sbjct  1    MVRARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKNNPFYFNSDRWFHTLFR 60
Query  59   NQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTL 118
            NQ+GHLRV++RFDQRSKQ+QNLENYRVVE+ SKPNTLLLPHHADADFLLVVLNGRA+LTL
Sbjct  61   NQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHHADADFLLVVLNGRAVLTL 120
Query  119  VNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTE 178
            VNPDGRDS ILEQGHAQKIPAGTTFFLVNP+DN+NLRIIKLA+PVNNPHRFQ+FFLSSTE
Sbjct  121  VNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLAVPVNNPHRFQDFFLSSTE 180
Query  179  AQQSYLRGFSKNILEASFDSDFKEIDRVLFGEE-RQQQHGEESQEEGVIVELKREQIREL 237
            AQQSYL+GFSKNILEASFDSD KEI RVLFGEE +QQQ+G+ESQ+EGVIVELKREQIREL
Sbjct  181  AQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIREL 240
Query  238  IKHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKE 297
             KHAKSSS+K LSS+D+PFNLRN  PIYSNK+GRW+EITPEKNPQL+DLD+FI SVDMKE
Sbjct  241  TKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKE 300
Query  298  GGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQ----DESLEVQRYRAELSEDDVFV 353
            G LLLPHYNSKAIVILVINEG+A IELVG  +QQ+Q    +ES EVQRYRAELSEDDVF+
Sbjct  301  GSLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRAELSEDDVFI 360
Query  354  IPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVE 413
            IPA YPVAINATSNLNFFAFGINAENNQRNFLAGEKDNV+SEIPTEVLDV+FPASG KV+
Sbjct  361  IPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVK 420
Query  414  KLIKKQSESHFVDAQPEQQQREEGHKGRKG 443
            KLIKKQSES+FVDAQPEQQ+REE  KG KG
Sbjct  421  KLIKKQSESQFVDAQPEQQEREEARKGGKG 450

Sequence Alignment: 3. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 455.5 bits 1971,  Expect = 3e-129
 Identities = 295/423 69%, Positives = 369/423 87%, Gaps = 7/423 1%
Query  28   EHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVE 87
            E  ESQ E       NPF+FNS +RF+TLFKNQYGH+RV++RF++RS+Q+QNL +YR++E
Sbjct  133  EGSESQREPRRHKNKNPFHFNS-KRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILE 191
Query  88   FKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVN 147
            F SKPNTLLLPHHADAD+L+V+LNG AILTLVN D RDSY L+ G A ++PAGTT+++VN
Sbjct  192  FNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVN 251
Query  148  PNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVL 207
            P++++NLR+I LAIPVN P RF++FFLSST+AQQSYL+GFSKNILEAS+D+ F+EI++VL
Sbjct  252  PDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVL 311
Query  208  FGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSN 267
            FG E  QQ+GEE  +E VIVE+ ++QIREL KHAKSSSRK +SS+D+PFNLR+ +PIYSN
Sbjct  312  FGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSN 371
Query  268  KFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP 327
            K+G+ +EITPEKNPQL+DLDVF+S VDM EG L+LPH+NSKAIV+LVINEGEA IELVG 
Sbjct  372  KLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGI 431
Query  328  SDQQQ---QDES-LEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRN 383
             +QQQ   Q+E  LEV++YRAELSE D+FVIPA YPV +NATS+LNFFAFGINAENNQRN
Sbjct  432  KEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGINAENNQRN 491
Query  384  FLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKG 443
            FLAG KDNV+S+IP++V +++FP S   +E LIK QSES+FVDAQP  QQ+EEG+KGRKG
Sbjct  492  FLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQP--QQKEEGNKGRKG 549
Query  444  SLSSILGSLY 453
             LSSIL ++Y
Sbjct  550  PLSSILRAFY 559

Sequence Alignment: 4. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 443.3 bits 1917,  Expect = 1e-125
 Identities = 306/433 70%, Positives = 376/433 86%, Gaps = 26/433 6%
Query  1    MVRARVQLL--LGILFLASLSVSFGIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFK 58
            M+R R  LL  LG +FLAS+ VS+ +  RE +           NNPFYF S   F+TLF+
Sbjct  1    MMRVRFPLLVLLGTVFLASVCVSLKV--REDE-----------NNPFYFRSSNSFQTLFE 47
Query  59   NQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTL 118
            NQ   +R+++RF++RS Q++NL +YR+V+F+SKPNT+LLPHHADADFLL VL+GRAILTL
Sbjct  48   NQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTL 107
Query  119  VNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTE 178
            VN D RDSY L  G AQ+IPAGTT++LVNP+D+ NL+IIKLAIPVN P R+ +FFLSST+
Sbjct  108  VNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQ 167
Query  179  AQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELI 238
            AQQSYL+GFS NILE SF S+F+EI+RVLFGEE +Q+     Q+EGVIVEL +EQIR+L 
Sbjct  168  AQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQR-----QQEGVIVELSKEQIRQLS 222
Query  239  KHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEG 298
            + AKSSSRK +SS+DEPFNLR+ NPIYSN FG+++EITPEKNPQL+DLD+F+SSVD+ EG
Sbjct  223  RRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEG 282
Query  299  GLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQ----DESLEVQRYRAELSEDDVFVI 354
             LLLPH+NSKAIVILVINEG+A IELVG  +QQQ+    +E LEVQRYRAELSEDDVFVI
Sbjct  283  ALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVI 342
Query  355  PAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEK 414
            PAAYP  +NATSNLNF+AFGINAENNQRNFLAGEKDNV+ +I  +V +++FP S   VE+
Sbjct  343  PAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVER 402
Query  415  LIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY 453
            L+KKQ ES+FVDAQP  QQ+EEG KGRKG + SILG+LY
Sbjct  403  LLKKQRESYFVDAQP--QQKEEGSKGRKGPFPSILGALY 439

Sequence Alignment: 5. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 440.5 bits 1905,  Expect = 1e-124
 Identities = 285/425 67%, Positives = 367/425 86%, Gaps = 8/425 1%
Query  26   HREHQESQEESDSRGQN-NPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYR 84
            +RE +ES++    R +N NPF F S+R F TLFKNQYG +RV++RF+QRS Q+QNL +YR
Sbjct  114  QRESEESEDSELRRHKNKNPFLFGSNR-FETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR 172
Query  85   VVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFF 144
            ++EF SKPNTLLLP+HADAD+L+V+LNG AIL+LVN D RDSY L+ G A ++P+GTT++
Sbjct  173  ILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYY 232
Query  145  LVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEID 204
            +VNP++N+NLR+I LAIPVN P RF++FFLSSTEAQQSYL+GFS+NILEAS+D+ F+EI+
Sbjct  233  VVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEIN 292
Query  205  RVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPI 264
            +VLF  E  QQ+GE+  +E VIVE+ +EQIR L K AKSSSRK +SS+D+PFNLR+ +PI
Sbjct  293  KVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPI 352
Query  265  YSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIEL 324
            YSNK+G+++EITPEKNPQL+DLD+F+S VDM EG LLLPH+NSKAIVILVINEG+A IEL
Sbjct  353  YSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIEL 412
Query  325  VG----PSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENN 380
            VG      +QQQ+++ LEV++YRAELSE D+FVIPA YPV +NATSNLNFFA GINAENN
Sbjct  413  VGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENN 472
Query  381  QRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKG 440
            QRNFLAG +DNV+S+IP++V +++FP S   VEKL+K Q ES+FVDAQP  +++EEG+KG
Sbjct  473  QRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP--KKKEEGNKG 530
Query  441  RKGSLSSILGSLY 453
            RKG LSSIL ++Y
Sbjct  531  RKGPLSSILRAFY 543

Sequence Alignment: 6. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 440.5 bits 1905,  Expect = 1e-124
 Identities = 285/425 67%, Positives = 367/425 86%, Gaps = 8/425 1%
Query  26   HREHQESQEESDSRGQN-NPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYR 84
            +RE +ES++    R +N NPF F S+R F TLFKNQYG +RV++RF+QRS Q+QNL +YR
Sbjct  176  QRESEESEDSELRRHKNKNPFLFGSNR-FETLFKNQYGRIRVLQRFNQRSPQLQNLRDYR 234
Query  85   VVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFF 144
            ++EF SKPNTLLLP+HADAD+L+V+LNG AIL+LVN D RDSY L+ G A ++P+GTT++
Sbjct  235  ILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYY 294
Query  145  LVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEID 204
            +VNP++N+NLR+I LAIPVN P RF++FFLSSTEAQQSYL+GFS+NILEAS+D+ F+EI+
Sbjct  295  VVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEIN 354
Query  205  RVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPI 264
            +VLF  E  QQ+GE+  +E VIVE+ +EQIR L K AKSSSRK +SS+D+PFNLR+ +PI
Sbjct  355  KVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPI 414
Query  265  YSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIEL 324
            YSNK+G+++EITPEKNPQL+DLD+F+S VDM EG LLLPH+NSKAIVILVINEG+A IEL
Sbjct  415  YSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIEL 474
Query  325  VG----PSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENN 380
            VG      +QQQ+++ LEV++YRAELSE D+FVIPA YPV +NATSNLNFFA GINAENN
Sbjct  475  VGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENN 534
Query  381  QRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKG 440
            QRNFLAG +DNV+S+IP++V +++FP S   VEKL+K Q ES+FVDAQP  +++EEG+KG
Sbjct  535  QRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP--KKKEEGNKG 592
Query  441  RKGSLSSILGSLY 453
            RKG LSSIL ++Y
Sbjct  593  RKGPLSSILRAFY 605

Sequence Alignment: 7. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 336.1 bits 1447,  Expect = 3e-93
 Identities = 295/422 69%, Positives = 367/422 86%, Gaps = 27/422 6%
Query  28   EHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVE 87
            E  ESQ E       NPF+FNS +RF+TLFKNQYGH+RV++RF++RS+Q+QNL +YR++E
Sbjct  195  EGSESQREPRRHKNKNPFHFNS-KRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILE 253
Query  88   FKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVN 147
            F SKPNTLLLPHHADAD+L+V+LNG AILTLVN D RDSY L+ G A ++PAGTTF++VN
Sbjct  254  FNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVN 313
Query  148  PN------------------DND-NLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFS 188
            P+                  DND NLR+I LAIPVN P RF++FFLSST+AQQSYL+GFS
Sbjct  314  PDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFS 373
Query  189  KNILEASFDSDFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKE 248
            KNILEAS+D+ F+EI++VLFG E  QQ+GEE  +E VIVE+ ++QIREL KHAKSSSRK 
Sbjct  374  KNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKT 433
Query  249  LSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSK 308
            +SS+D+PFNL + +PIYSNK+G+ +EIT ++NPQL+DLDVF+S VDM EG L+LPH+NSK
Sbjct  434  ISSEDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSK 492
Query  309  AIVILVINEGEAKIELVGPSDQQQ---QDES-LEVQRYRAELSEDDVFVIPAAYPVAINA 364
            AIV+LVINEGEA IELVG  +QQQ   Q+E  LEV++YRAELSE D+FVIPA YPV +NA
Sbjct  493  AIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNA 552
Query  365  TSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHF 424
            TS+LNFFAFGINAENNQRNFLAG KDNV+S+IP++V +++FP S   +E LIK QSES+F
Sbjct  553  TSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQSESYF 612
Query  425  VDAQPEQQQREEGHKGRKGSLSSILGSLY 453
            VDAQP  QQ+EEG+KGRKG LSSIL ++Y
Sbjct  613  VDAQP--QQKEEGNKGRKGPLSSILRAFY 639

Sequence Alignment: 8. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 284.3 bits 1220,  Expect = 1e-77
 Identities = 247/428 57%, Positives = 350/428 81%, Gaps = 21/428 4%
Query  25   VHREHQESQEES--DSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLEN 82
            VHRE +E +++S  DSR Q NP++F+S+R F+T ++N+ G++RV+ RF+QR+ +++NL+N
Sbjct  164  VHREEREQEQDSRSDSRRQRNPYHFSSNR-FQTYYRNRNGQIRVLERFNQRTNRLENLQN 222
Query  83   YRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTT 142
            YR++EF+SKPNTL+LP H+DADF+LVVLNGRA +T+VNPD R  Y LEQG A ++PAGTT
Sbjct  223  YRIIEFQSKPNTLILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTT 282
Query  143  FFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKE 202
             +++NP+DN NLR+ KLAIP+NNP ++ +F+ S+T+ QQSY+ GFSKN LEA+F++ ++E
Sbjct  283  SYILNPDDNQNLRVAKLAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEE 342
Query  203  IDRVLFG-----EERQQQHGEES--QEEGVIVELKREQIRELIKHAKSSSRKELSSQDEP 255
            I+RVL+G     E  +Q+ G+E   Q+EGVIV + ++QI+EL KHA+SSS +   S+  P
Sbjct  343  IERVLLGDDELQENEKQRRGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSESGP 402
Query  256  FNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVI 315
            FNLR++ PIYSNKFG +YEITP+ NPQ++DL++ ++  ++ EG LLLPHYNSKAI I+V+
Sbjct  403  FNLRSNKPIYSNKFGNFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVV 462
Query  316  NEGEAKIELVGPSDQQ-QQDESLE--------VQRYRAELSEDDVFVIPAAYPVAINATS 366
            +EGE   ELVG  DQQ QQDE  E        V+RY  +LS+ DVF+IPA +P++INA+S
Sbjct  463  DEGEGNYELVGIRDQQRQQDEQEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASS 522
Query  367  NLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVD 426
            NL ++ FGINA  NQRNFLAG +DNV+ ++  EV +++FP S   VE+LIK Q +S+F +
Sbjct  523  NLRLLGFGINANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFAN 582
Query  427  AQPEQQQ-RE-EGHKGRKGSLSSILGSLY 453
            AQP+QQQ RE EG +GR+G +SSIL +LY
Sbjct  583  AQPQQQQQREKEGRRGRRGPISSILNALY 611

Sequence Alignment: 9. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 268.9 bits 1152,  Expect = 3e-73
 Identities = 224/390 57%, Positives = 330/390 84%, Gaps = 20/390 5%
Query  41   QNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH 100
            Q NPF F S+R F+T+++N+ GH+R++++FD+RSK  +NL+NYR++E+KSKP+TL+LP++
Sbjct  5    QENPFIFKSNR-FQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
Query  101  ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLA 160
             DADF+LVVL+G+A+LT++N + R+S+ LE+G   K+PAGT  +L N +DN++LR++ LA
Sbjct  64   TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
Query  161  IPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQ-QHG-- 217
            IPVNNP ++++F+LS T+ Q S+L GF+K+ILEA+F++D++EI++VL+ ++ Q+ QH   
Sbjct  124  IPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQHRRS 183
Query  218  -----EESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRW 272
                 +E  +E VIV++ REQI+EL K+AKSSS+K +SS+ EPFNLR+ NPIYSNKFG++
Sbjct  184  LRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKF 243
Query  273  YEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQ 332
            +EITPEKNPQL+DLD+F++SV++KEG LLLP+YNS+AIVI+ +NEG+   ELVG  ++ Q
Sbjct  244  FEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQ 303
Query  333  QDE-----------SLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQ 381
            ++E           S +VQRYRA+LS  DVFV+PA +PVAINA+S+LN+  FGINA+NNQ
Sbjct  304  REENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQ 363
Query  382  RNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQ 431
            RNFLAGE+DNV+S+I   V +++FP S  +V++L+  Q +SHF +AQP Q
Sbjct  364  RNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQ 413

Sequence Alignment: 10. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 268.5 bits 1150,  Expect = 5e-73
 Identities = 228/390 58%, Positives = 326/390 83%, Gaps = 23/390 5%
Query  41   QNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH 100
            Q NPF F S+R F+T+++N+ GH+R+++RFD+RSK  +NL+NYR++E+KSKP+T++LP+ 
Sbjct  5    QENPFIFKSNR-FQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF 63
Query  101  ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLA 160
             DADF+LVVL+G+AILT++N + R+S+ LE+G   K+PAGT  +L N +DN++LR++ LA
Sbjct  64   TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
Query  161  IPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQ-QHG-- 217
            IPVN P ++Q+F+LS T+ Q S+L GFSKNILEA+F+++++EI++VL+ E+ Q+ QH   
Sbjct  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
Query  218  --EESQE---EGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRW 272
              ++ QE   E VIV++ REQI EL K+AKSSS+K +SS+ EPFNLR+ NPIYSNKFG++
Sbjct  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKF 243
Query  273  YEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQ 332
            +EITPEKNPQL+DLD+F++SV++KEG LLLP+YNS+AIVI+ +NEG+   ELVG  ++ Q
Sbjct  244  FEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQ 303
Query  333  QDESLE--------------VQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAE 378
            Q++  E              VQRYRA LS  DV+VIPA +PVAINA+S+LN+  FGINA+
Sbjct  304  QEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAK 363
Query  379  NNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQ 431
            NNQRNFLAGE+DNV+S+I   V +++FP S  +V++L+  Q +SHF +AQP Q
Sbjct  364  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQ 416

Sequence Alignment: 11. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 262.3 bits 1123,  Expect = 3e-71
 Identities = 225/392 57%, Positives = 326/392 83%, Gaps = 20/392 5%
Query  41   QNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH 100
            Q NPF F S+R F+TL++N+ GH+R++++FD+RSK  +NL+NYR++E+KSKP+TL+LP++
Sbjct  5    QENPFIFKSNR-FQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY 63
Query  101  ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLA 160
             DADF+LVVL+G+A LT++  + R+S+ LE+G A K+PAGT  +L N +DN++LR++ LA
Sbjct  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVLDLA 123
Query  161  IPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQ-QHG-- 217
            IPVN P ++Q+F+LS T+ Q S L GFSKNILEA+F+++++EI++VL+ ++ Q+ QH   
Sbjct  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
Query  218  -----EESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRW 272
                 +E  EE VIV++ REQI EL K+AKSSS+K +SS+  PFNLR+ NPIYSNKFG++
Sbjct  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKF 243
Query  273  YEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQ 332
            +EITPEKN QL+DLD+F++SVD+KEG LLLP+YNS+AIVI+ + EG+   ELVG  ++ Q
Sbjct  244  FEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQ 303
Query  333  ---------QDE--SLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQ 381
                     Q+E  S +VQ YRA+LS  DVFVIPA +PVAINA+S+LN+  FGINAENN+
Sbjct  304  GKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNE 363
Query  382  RNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQ 433
            RNFLAGE+DNV+S++   V +++FP S ++V++L+K Q +S+F +AQP Q++
Sbjct  364  RNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 12. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 258.4 bits 1106,  Expect = 5e-70
 Identities = 223/392 56%, Positives = 322/392 82%, Gaps = 20/392 5%
Query  41   QNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH 100
            Q NPF F S+R F+TL++N+ GH+R++++FD+RSK  +NL+NYR++E+KSKP TL+LP+ 
Sbjct  5    QENPFIFKSNR-FQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFLPQC 63
Query  101  ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLA 160
             DADF+LVVL+G+A LT++  + R+S+ LE+G   K+PAGT  +L N +DN++LR++ L 
Sbjct  64   TDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLT 123
Query  161  IPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQ-QHG-- 217
            IPVN P ++Q+F+LS T+ Q S L GFSKNILEA+F+++++EI++VL+ ++ Q+ QH   
Sbjct  124  IPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQHRRS 183
Query  218  -----EESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRW 272
                 +E  EE VIV++ REQI EL K+AKSSS+K +SS+  PFNLR+ NPIYSNKFG++
Sbjct  184  LKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKFGKF 243
Query  273  YEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQ 332
            +EITPEKN QL+DLD+F++SVD+KEG LLLP+YNS+AIVI+ + EG+   ELVG  ++ Q
Sbjct  244  FEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRNENQ 303
Query  333  ---------QDE--SLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQ 381
                     Q+E  S +VQ YRA+LS  DVFVIPA +PVAINA+S+LN+  FGINAENN+
Sbjct  304  GKENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGINAENNE 363
Query  382  RNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQ 433
            RNFLAGE+DNV+S++   V +++FP S ++V++L+K Q +S+F +AQP Q++
Sbjct  364  RNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 13. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 233.1 bits 995,  Expect = 2e-62
 Identities = 163/407 40%, Positives = 282/407 69%, Gaps = 34/407 8%
Query  27   REHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVV 86
            R   + +EE   R  +NP+YF+S +   +  +++ G ++ + RF +R++ ++ +ENYRVV
Sbjct  54   RRESKGREEEQQR--HNPYYFHS-QSIRSRHESEEGEVKYLERFAERTELLRGIENYRVV 110
Query  87   EFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLV 146
             + + PNT++LPHH DA+ ++VV  GRA LTLV+ + R+S+ LE G   ++PAG T +++
Sbjct  111  ILDANPNTFMLPHHKDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVI 170
Query  147  NPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEA-QQSYLRGFSKNILEASFDSDFKEIDR 205
            N + N+ L ++KL  PVNNP + + ++ +  ++  QSYLR FS +IL A++++    ++R
Sbjct  171  NQDSNERLEMVKLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER 230
Query  206  VLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS--SQDEPFNLRNSNP 263
             +     QQ+     Q EGVI+   +E++R L +HA S+ ++     S   P +L++  P
Sbjct  231  FF----DQQE-----QREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERP 281
Query  264  IYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIE 323
             YSN+FG+++E  PE++ QL+++DV+++  ++K G +++PHYNSKA V++ + EG  + E
Sbjct  282  SYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYE 341
Query  324  LVGPS-------DQ----QQQDESL-EVQRYRAELSEDDVFVIPAAYPVAINATSNLNF- 370
            +  P        DQ    Q+++ES    Q+  A L+  D+FVIPA +P+AI A+ N N+ 
Sbjct  342  MACPHVSSQSFEDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLR 401
Query  371  -FAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQP 429
             + FGIN ENNQRNFLAG+ +++++++  E  ++SF     ++E++ + Q ES+FV   P
Sbjct  402  LLGFGINGENNQRNFLAGQ-NSIINQLEREAKELSFNMPREEIEEIFESQMESYFV---P 457
Query  430  EQQQREEGHKGRKGSLSSILG 450
             ++Q   G +GR   L+SILG
Sbjct  458  TERQSRRG-QGRDHPLASILG 477

Sequence Alignment: 14. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 230.4 bits 982,  Expect = 7e-62
 Identities = 149/213 69%, Positives = 186/213 87%, Gaps = 6/213 2%
Query  239  KHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEG 298
            K AKSSSRK +SS+D+PFNL + +PIYS K+G+++EITPEKNPQL+DLD+F+S VDM EG
Sbjct  2    KRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEG 61
Query  299  GLLLPHYNSKAIVILVINEGEAKIELVG----PSDQQQQDESLEVQRYRAELSEDDVFVI 354
             LLLPH+NSKAIVILVINEG+A IELVG      +QQQ+++ LEV++YRAELSE D+FVI
Sbjct  62   ALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVI 121
Query  355  PAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEK 414
            PA YPV +NATSNLNFFA GINAENNQRNFLAG +DNV+S+IP++V +++FP S   VEK
Sbjct  122  PAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEK 181
Query  415  LIKKQSESHFVDAQPEQQQREEGHKGRKGSLSSILGSLY 453
            L+K Q ES+FVDAQP   ++EEG+KGRKG LSSIL ++Y
Sbjct  182  LLKNQRESYFVDAQPN--EKEEGNKGRKGPLSSILRAFY 218

Sequence Alignment: 15. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 230.1 bits 982,  Expect = 2e-61
 Identities = 163/406 40%, Positives = 280/406 68%, Gaps = 34/406 8%
Query  27   REHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVV 86
            R     +EE   R  +NP+YF+S +   +  +++ G ++ + RF +R++ ++ +ENYRVV
Sbjct  166  RRESRGREEEQQR--HNPYYFHS-QSIRSRHESEEGEVKYLERFTERTELLRGIENYRVV 222
Query  87   EFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLV 146
             + + PNT +LPHH DA+ + VV  GRA LTLV+ + R+S+ LE G   ++PAG T +++
Sbjct  223  ILDANPNTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVI 282
Query  147  NPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEA-QQSYLRGFSKNILEASFDSDFKEIDR 205
            N + N+ L ++KL  PVNNP +F+ ++ +  ++  QSYLR FS +IL A++++    ++R
Sbjct  283  NQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER 342
Query  206  VLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS--SQDEPFNLRNSNP 263
             +F    QQ+     Q EGVI+   +E++R L +HA S+ ++     S   P +L++ +P
Sbjct  343  -FFD---QQE-----QREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESP 393
Query  264  IYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIE 323
             YSN+FG+++E  PE++ QL+++DV+++  ++K G +++PHYNSKA V++ + EG  + E
Sbjct  394  SYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYE 453
Query  324  LVGP--SDQ---------QQQDESL-EVQRYRAELSEDDVFVIPAAYPVAINATSNLNF- 370
            +  P  S Q         Q+++ES    Q+  A L+  D+FVIPA +P+AI A+ N N+ 
Sbjct  454  MACPHVSSQSYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLR 513
Query  371  -FAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQP 429
             + F IN ENNQR+FLAG+ +N+++++  E  ++SF     ++E++ + Q ES+FV   P
Sbjct  514  LLGFDINGENNQRDFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFESQMESYFV---P 569
Query  430  EQQQREEGHKGRKGSLSSIL 449
             ++Q   G +GR   L+SIL
Sbjct  570  TERQSRRG-QGRDHPLASIL 588

Sequence Alignment: 16. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 215.3 bits 917,  Expect = 7e-57
 Identities = 155/404 38%, Positives = 263/404 65%, Gaps = 29/404 7%
Query  34   EESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPN 93
            EE + +  +NP+YF+ +R + T F+ + GH+ V+  F  RSK ++ L+NYR+V +++ PN
Sbjct  200  EEGEEKQSDNPYYFD-ERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPN 258
Query  94   TLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDN 153
             ++LP H DAD +L+V+ GR  L +++ D R+SY LE G   +IPAGTTF+L+N ++N+ 
Sbjct  259  AFVLPTHLDADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNER 318
Query  154  LRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQ 213
            L I K+   ++ P +++ FF +  +  + YL  FSK ILEA++++  + +  VL G++R 
Sbjct  319  LHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVL-GQQR- 376
Query  214  QQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDE----PFNLRNSNPIYSNKF 269
                     EGVI+   +EQIREL +    S R  +    E    P+NL N  P+YSNK+
Sbjct  377  ---------EGVIIRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKY 427
Query  270  GRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP-- 327
            G+ YE+ PE   QL+D+DV +   ++ +G ++ P +N+++  ++V+  GEA +E+  P  
Sbjct  428  GQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHL 487
Query  328  ---------SDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGIN 376
                       +++++E +  ++ RA LS+ +  V+ A +PV   ++ N N+  FAFGIN
Sbjct  488  SGRHGGRGGGKRHEEEEEVHYEQVRARLSKREAIVVLAGHPVVFVSSGNENLLLFAFGIN 547
Query  377  AENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREE 436
            A+NN+ NFLAG + NV+ +I  + ++++F AS  +VE+L   Q ES F     ++QQ+  
Sbjct  548  AQNNHENFLAGRERNVLQQIEPQAMELAFAASRKEVEELFNSQDESIFFPGPRQHQQQSP 607
Query  437  GHKGRKGSLSSIL 449
                ++  L SIL
Sbjct  608  RSTKQQQPLVSIL 620

Sequence Alignment: 17. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 214.1 bits 912,  Expect = 2e-56
 Identities = 153/404 37%, Positives = 261/404 64%, Gaps = 29/404 7%
Query  34   EESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPN 93
            EE + +  +NP+YF+ +R + T F+ + GH+ V+  F  RSK ++ L+NYR+V +++ PN
Sbjct  241  EEGEEKQSDNPYYFD-ERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPN 299
Query  94   TLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDN 153
             ++LP H DAD +L+V  GR  L +++ D R+SY LE G   +IPAGTTF+L+N ++N+ 
Sbjct  300  AFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNER 359
Query  154  LRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQ 213
            L I K+   ++ P +++ FF +  +  + YL  FSK ILEA++++  + +  VL G++R 
Sbjct  360  LHIAKFLQTISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL-GQQR- 417
Query  214  QQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDE----PFNLRNSNPIYSNKF 269
                     EGVI+   +EQIREL +    S R  +    E    P+NL N  P+YSNK+
Sbjct  418  ---------EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKY 468
Query  270  GRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGP-- 327
            G+ YE+ PE   QL+D+DV +   ++ +G ++ P +N+++  ++V+  GEA +E+  P  
Sbjct  469  GQAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHL 528
Query  328  ---------SDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGIN 376
                       +++++E +  ++ +A LS+ +  V+P  +PV   ++ N N+  FAFGIN
Sbjct  529  SGRHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENLLLFAFGIN 588
Query  377  AENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREE 436
            A+NN+ NFLAG + NV+ +I  + ++++F A   +VE+L   Q ES F     ++QQ+  
Sbjct  589  AQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIFFPGPRQHQQQSS 648
Query  437  GHKGRKGSLSSIL 449
                ++  L SIL
Sbjct  649  RSTKQQQPLVSIL 661

Sequence Alignment: 18. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 200.2 bits 851,  Expect = 3e-52
 Identities = 159/406 39%, Positives = 283/406 69%, Gaps = 35/406 8%
Query  27   REHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVV 86
            R     +EE   R  +NP+YF+S + + +  ++  G ++ + RF +R++ ++ +ENYRVV
Sbjct  363  RRESRGREEEQQR--HNPYYFHS-QGLRSRHESGEGEVKYLERFTERTELLRGIENYRVV 419
Query  87   EFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLV 146
             +++ PNT++LP+H DA+ ++VV  GRA LT+V+ + R+S+ LE G   ++PAG T +++
Sbjct  420  ILEANPNTFVLPYHKDAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVI 479
Query  147  NPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRV 206
            N + N+ L ++KL  PVNNP +F+ ++ +  ++ +SYLR FS +IL A++++    ++R 
Sbjct  480  NQDSNERLEMVKLLQPVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLER- 538
Query  207  LFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELS--SQDEPFNLRNSNPI 264
            +F    QQ+     Q EGVI+   +E++R L +HA S+ ++     S   P +L++    
Sbjct  539  FFD---QQE-----QREGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSS 590
Query  265  YSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIEL 324
            YSN+FG+++E  PE++ QL+++DV+++  ++K G +++PHYNSKA V++ + EG  + E+
Sbjct  591  YSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEM 650
Query  325  VGPSD------------QQQQDESL--EVQRYRAELSEDDVFVIPAAYPVAINATSNLNF 370
              P D            +Q+++ES   + Q+  A L+  D+FVIPA +P+AI A+ N N+
Sbjct  651  ACPHDVSSQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENL 710
Query  371  --FAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQ 428
                FGIN +NNQRNFLAG+ +N+++++  E  ++SF     ++E++ ++Q ES+FV   
Sbjct  711  RLVGFGINGKNNQRNFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFERQVESYFV--- 766
Query  429  PEQQQREEGHKGRKGSLSSIL 449
            P ++Q   G +GR   L+SIL
Sbjct  767  PMERQSRRG-QGRDHPLASIL 786

Sequence Alignment: 19. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 173.8 bits 735,  Expect = 2e-44
 Identities = 152/394 38%, Positives = 257/394 65%, Gaps = 36/394 9%
Query  30   QESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFK 89
            +E  EE +    +NPF+F+  R F++ F+ ++G++RV++RF  R   ++ +  +R+  ++
Sbjct  167  EEETEEGEQEQSHNPFHFHR-RSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILE 225
Query  90   SKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPN 149
            + PNT++LPHH DA+ + +V NGR  LT++  + ++SY +  G   ++PAG+T +L N +
Sbjct  226  ANPNTFVLPHHCDAEKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQD 285
Query  150  DNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFG 209
            + + L I  L  PVNNP +F+ FF + ++  QSYLR FS+ ILE +F++  +++D  LFG
Sbjct  286  NKEKLIIAVLHRPVNNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDE-LFG 344
Query  210  EERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSNKF 269
               +Q H    Q +G+  +  +EQIR L + A  +S +E S +   FNL    P YSN+ 
Sbjct  345  --GRQSH-RRQQGQGMFRKASQEQIRALSQEA--TSPREKSGERFAFNLLYRTPRYSNQN 399
Query  270  GRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPS- 328
            GR+YE  P +  QL D++V +S++ + +G +++PHYNSKA  ++++NEG   +E+V P  
Sbjct  400  GRFYEACPREFRQLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHL 459
Query  329  ----------DQQQQDESLEVQR------YRAELSEDDVFVIPAAYPVAINATSNLNF-- 370
                      +QQQ+ E  E +R       R++LS  D+FV+PA +PV   A+ N N+  
Sbjct  460  PRQSSFEEEEEQQQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRM 519
Query  371  FAFG-----INAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQ-SESHF 424
              FG     IN ++NQR F+AG K N + +  ++  +++F  S   V+++      ES+F
Sbjct  520  TGFGLYNQNINPDHNQRIFVAG-KINHVRQWDSQAKELAFGVSSRLVDEIFNNNPQESYF 578
Query  425  VDAQPEQQQR 434
            V     Q+QR
Sbjct  579  VS---RQRQR 585

Sequence Alignment: 20. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 170.4 bits 720,  Expect = 2e-43
 Identities = 151/412 36%, Positives = 260/412 63%, Gaps = 32/412 7%
Query  28   EHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVE 87
            E +E  +E + + +NNP+YF+  R F+  F+ ++G++RV++RF  +   ++ +  +R+  
Sbjct  166  EEEEESDEGEQQQRNNPYYFHR-RSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAI 224
Query  88   FKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVN 147
            +++ PNT++LPHH DA+ + VV NGR  +T+V  + ++SY +  G   +IPAG+T +L N
Sbjct  225  LEANPNTFVLPHHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLAN 284
Query  148  PNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVL 207
             ++ + L I  L  PVNNP +FQ FF +  E  QSYLR FS+ ILEA F++  +++D + 
Sbjct  285  QDNREKLTIAVLHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLDELP 344
Query  208  FGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSN 267
             G   +Q H    Q +G+  +  +EQIR L + A S   K   S+   FNL +  P YSN
Sbjct  345  GG---RQSH-RRQQGQGMFRKASQEQIRALSQGATSPRGK--GSEGYAFNLLSQTPRYSN 398
Query  268  KFGRWYEITPEK-NPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVG 326
            + GR+YE  P     QL+++D  + + ++ +G +++PHYNSKA  ++++ EG   +E+V 
Sbjct  399  QNGRFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVC 458
Query  327  P------SD-----QQQQDE------SLEVQRYRAELSEDDVFVIPAAYPVAINATSN-- 367
            P      SD     +++Q+E      S + +R RA+LS  ++FV+PA +PV   A+ N  
Sbjct  459  PHLSRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNED 518
Query  368  LNFFAFGI-NAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQ-SESHFV 425
            L ++ FG+ N ++N+R F+AG+ +NV  +   +  +++F      V+++      ES+FV
Sbjct  519  LGLLGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFV 577
Query  426  DAQPEQQQREEGHKGRKGSLSSIL 449
              +  +   E   +G    LS  L
Sbjct  578  SGRDRRGFDER--RGSNNPLSPFL 599

Sequence Alignment: 21. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 153.5 bits 646,  Expect = 3e-38
 Identities = 227/415 54%, Positives = 324/415 78%, Gaps = 42/415 10%
Query  31   ESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKS 90
            E +EE+ SR  NNPFYF S RRF T + NQ G +RV++RFDQRSKQ QNL+N+R+V+ ++
Sbjct  158  EVREET-SR--NNPFYFPS-RRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEA 213
Query  91   KPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPND 150
            +PNTL+LP HADAD +LV+  G+A +T+ N + R S+ L++GHA +IP+G   +++N +D
Sbjct  214  RPNTLVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHD 273
Query  151  NDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGE 210
            N NLR+ K+++PVN P +F++FF +S+  Q SYL+GFS+N LEA+F+++F EI RVL+ E
Sbjct  274  NQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEE 333
Query  211  E---RQQQHGEE------SQEEGVIVELKREQIRELIKHAKSSSRKELSSQD--EPFNLR 259
                 Q++ G+       S  EGVIV++ +E+++EL KHAKS S+K    +D   P NLR
Sbjct  334  NAGGEQEERGQRRRSTRSSDNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLR 393
Query  260  NSNPIYSNKFGRWYEITPEK-NPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEG 318
            +  P  SN FGR +E+ P+K NPQL+DLD+ ++ V++KEG L+LPH+NSKA+VI+V+N+G
Sbjct  394  DGEPDLSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKG 453
Query  319  EAKIELVGPSDQQQQ-------------DE-----SLEVQRYRAELSEDDVFVIPAAYPV 360
               +ELV    +QQQ             DE     + EV+RY A L E DVF++PAA+PV
Sbjct  454  TGNLELVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPV 513
Query  361  AINATSNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQS 420
            AINA+S L+++ FGINAENN+R FLAG+KDNV+ +I  +  D++FP SG +VEKLIK Q 
Sbjct  514  AINASSELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQR 573
Query  421  ESHFVDAQP--------EQQQREEGHKGRKGSLSSIL 449
            ESHFV A+P        E++ +EE ++G KG L SIL
Sbjct  574  ESHFVSARPQSQSPSSPEKEDQEEENQGGKGPLLSIL 610

Sequence Alignment: 22. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 152.8 bits 643,  Expect = 5e-38
 Identities = 225/412 54%, Positives = 318/412 77%, Gaps = 47/412 11%
Query  35   ESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNT 94
            E  SR  NNPFYF S RRF T + NQ G +RV++RFDQRS+Q QNL+N+R+V+ ++KPNT
Sbjct  167  EETSR--NNPFYFPS-RRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNT 223
Query  95   LLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNL 154
            L+LP HADAD +LV+  G+A +T+ N + R S+ L++GHA +IP+G   +++N +DN NL
Sbjct  224  LVLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNL 283
Query  155  RIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEE--- 211
            R+ K+++PVN P +F++FF +S+  Q SYL+GFS+N LEA+F+++F EI RVL+ E    
Sbjct  284  RVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGG 343
Query  212  RQQQHGEE-----SQE--EGVIVELKREQIRELIKHAKSSSRK---ELSSQDEPFNLRNS 261
             Q++ G+      S E  EGVIV++ +E++ EL KHAKS S+K   E      P NLR  
Sbjct  344  EQEERGQRRWSTRSSENNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREG 403
Query  262  NPIYSNKFGRWYEITPEK-NPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEA 320
             P  SN FG+ +E+ P+K NPQL+DLD+ ++ V++KEG L+LPH+NSKA+VI+V+N+G  
Sbjct  404  EPDLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTG 463
Query  321  KIELVGPSDQQQQ--------DE-------SLEVQRYRAELSEDDVFVIPAAYPVAINAT 365
             +ELV    +QQQ        DE       + EV+RY A L E DVF++PAA+PVAINA+
Sbjct  464  NLELVAVRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINAS 523
Query  366  SNLNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFV 425
            S L+++ FGINAENN+R FLAG+KDNV+ +I  +  D++FP SG +VEKLIK Q ESHFV
Sbjct  524  SELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFV 583
Query  426  DAQP---------------EQQQREEGHKGRKGSLSSIL 449
             A+P               E++ +EE ++G KG L SIL
Sbjct  584  SARPQSQSQSPSSPEKESPEKEDQEEENQGGKGPLLSIL 622

Sequence Alignment: 23. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 137.5 bits 576,  Expect = 2e-33
 Identities = 144/392 36%, Positives = 241/392 61%, Gaps = 25/392 6%
Query  27   REHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVV 86
            RE +E QEE   RG+  P+ F  D+ F T F+ Q+G +RV+++F  RS+ ++ +ENYRV 
Sbjct  180  REREEEQEEQ-GRGRI-PYVFE-DQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVA 236
Query  87   EFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLV 146
             ++++P T+++P+H DA+ ++ V  GR  ++LV  D R+S  ++QG   KI AGTT +L+
Sbjct  237  ILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLI 296
Query  147  NPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRV 206
            N ++N+ L + KL  PV+ P  F+ FF +  E  +S+++ FS  ILEA+F++    + R+
Sbjct  297  NRDNNERLVLAKLLQPVSTPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRI 356
Query  207  LFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYS 266
             FG++RQ          GVIV+   EQ+R + +H +              N+    P +S
Sbjct  357  -FGQQRQ----------GVIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQRPTHS 405
Query  267  NKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVG 326
            N++G+ +E+   +  QL+DLD+ +S  ++ +G +  PHYNSKA  I ++ +GE   E+  
Sbjct  406  NQYGQLHEVDASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMAC 465
Query  327  P----SDQQQQDESL---EVQRYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGINA 377
            P    S    Q E+      QR  + L+   V +IPA +P    A+SN N+  + F +NA
Sbjct  466  PHMSRSRGSYQGETRGRPSYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNA 525
Query  378  ENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQR 434
             NN++  LAG + NVM+++  E  +++F     +VE++ + Q E  F    P QQQ+
Sbjct  526  NNNEKFPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFFFKG-PRQQQQ 580

Sequence Alignment: 24. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 137.3 bits 575,  Expect = 2e-33
 Identities = 135/392 34%, Positives = 232/392 59%, Gaps = 26/392 6%
Query  28   EHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVE 87
            E  E QEE D     NP+ F  D  F T  K + G + V+ +F +RSK ++ LE YR+  
Sbjct  116  EGDEEQEEED----ENPYVFE-DEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAF 170
Query  88   FKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVN 147
            + + P  +++P+H DAD ++ V  GR  +T +  + R+S  ++QG   +I AGT F++VN
Sbjct  171  LVANPQAFVVPNHMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVN 230
Query  148  PNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVL 207
             ++N+ L I+KL  PVN P  ++ F     E  +S+ R FS+ +LEA++ +   ++++ L
Sbjct  231  TDENEKLYIVKLLQPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEK-L 289
Query  208  FGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDE-PFNLRNSNPIYS 266
            F          E Q+EG IV+  +EQIR + +  +  S   ++ +    FNL   +P  S
Sbjct  290  F----------EKQDEGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQS 339
Query  267  NKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVG 326
            N +G+ +E   +  P L++LD+ +S V++ +GG+  P YNS+A  I ++  GE ++E+  
Sbjct  340  NNYGQLFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIAC 399
Query  327  PSDQQQQDESLE-----VQRYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGINAEN 379
            P     ++   E      ++  + +  D VFV+PA +P    A+ N N+  + F +NAE 
Sbjct  400  PHLSSSKNSGQEKSGPSYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEG 459
Query  380  NQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEG 437
            N R  LAG+K N++  +  E  +++F   G +V+K+  KQ E  F    P+ +Q ++G
Sbjct  460  NIRYTLAGKK-NIIEVMEKEAKELAFKTKGEEVDKVFGKQDEEFFFQG-PKWRQHQQG 515

Sequence Alignment: 25. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 132.8 bits 555,  Expect = 4e-32
 Identities = 147/401 36%, Positives = 241/401 60%, Gaps = 33/401 8%
Query  23   GIVHREHQESQEESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLEN 82
            G    E  E +E    R + NP+ F  D  F T  +   G ++V+ +F +RSK ++ +EN
Sbjct  79   GSSREEGYEEEELGGEREEENPYVFE-DEDFETRVRTDEGRIQVLEKFTKRSKLLRGIEN 137
Query  83   YRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTT 142
            +RV  +++ P T++ P H DA++++ V  GRA +T V  + R+++ +EQG   +IPAGT 
Sbjct  138  FRVAILEANPQTFISPAHFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTP 197
Query  143  FFLVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKE 202
             +L+N ++N+ L I+K+  PV+ P  F+ F  S  E  +S+ R FS  +LEA++ +   +
Sbjct  198  VYLINRDENEKLYIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQ 257
Query  203  IDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQD--EPFNLRN 260
            +++ LFG++ Q          GVI++  +EQIR + KH +++ R      D   PFNL +
Sbjct  258  LEK-LFGKQTQ----------GVIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLFH 306
Query  261  SNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEA 320
              P  SN+FGR +E  P++  QL+DLD+ +S  ++ +G +  P+YNS+A  I V+ EGE 
Sbjct  307  KRPSQSNQFGRLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEG 366
Query  321  KIELVGP----SDQQQQDESL-----------EVQRYRAELSEDDVFVIPAAYPVAINAT 365
              E+  P    S  + Q E               Q+ R  L    VFV PA +PVA+ A+
Sbjct  367  YFEMACPHLSSSGSRGQREGSGSSRRRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIAS 426
Query  366  SNLNF--FAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESH 423
             N N+  + F +NA+ N R  LAG K+N+++E   E  +++F     +VEK+ + Q +  
Sbjct  427  RNKNLQVLCFDVNAQGNIRFPLAG-KNNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEF 485
Query  424  FVDAQPEQQQREEG 437
            F    P +Q  E G
Sbjct  486  FFPG-PSRQPEEGG 498

Sequence Alignment: 26. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 122.5 bits 510,  Expect = 4e-29
 Identities = 133/399 33%, Positives = 234/399 58%, Gaps = 32/399 8%
Query  23   GIVHREHQESQEES--DSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNL 80
            G+   EH   +     +   + NP+ F+SDR F     ++ G +R +  F + S+ ++ +
Sbjct  43   GVFPEEHGRGHHRGGREEEREENPYVFHSDR-FRIRASSEAGEIRALPNFGEVSELLEGI 101
Query  81   ENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAG 140
              YRV   + KPNT++LPH+ DA ++L V  GR  +  V  +      LE+G    +P+G
Sbjct  102  SRYRVTCIEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSG 161
Query  141  TTFFLVNPNDNDNLRIIKLAIPVNNPHR--FQNFFLSSTEAQQSYLRGFSKNILEASFDS 198
             TF+LVN +D+++LRI  L +   +  R  ++ F+++     ++    FS ++LEA+F++
Sbjct  162  HTFYLVNNDDHNSLRIASL-LRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNT 220
Query  199  DFKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSS-QDEPFN 257
            D ++++ + FG  R+          GVI     EQIRE+++    S+    +S Q +PFN
Sbjct  221  DVQKLEHI-FGAHRR----------GVIFYANEEQIREMMRRGGFSAESTSASEQPKPFN 269
Query  258  LRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINE 317
            LRN  P + N  GR+    P+ NP L  +DV +    +  G +  P +N+KA  I ++ E
Sbjct  270  LRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVME 329
Query  318  GEAKIELVGP---------SDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSN- 367
            GE +IE+  P         S +++  + +  +R RA L    V+V+PA +P+   A++N 
Sbjct  330  GEGRIEMACPHLGQEHGWSSPRERGHQDINYERVRARLRTGTVYVVPAGHPITEIASTNG 389
Query  368  -LNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPAS-GNKVEKLIKKQSESHFV 425
             L  + F IN   N+R FLAG K+NV+  +  EV  +SF    G ++E++++ Q + + +
Sbjct  390  RLEILWFDINTSGNEREFLAG-KNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKD-QVI 447
Query  426  DAQPEQQQREE 436
               P++Q+R+E
Sbjct  448  LRGPQRQRRDE 458

Sequence Alignment: 27. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 103.2 bits 425,  Expect = 3e-23
 Identities = 145/399 36%, Positives = 243/399 60%, Gaps = 22/399 5%
Query  26   HREHQESQEESDSRGQN-NPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYR 84
            ++E   S EES  + Q  NP+ F  D  F +  K + G ++V+  F +RS+ +  +EN+R
Sbjct  42   QQEEGNSSEESYGKEQEENPYVFQ-DEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFR 100
Query  85   VVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFF 144
            +  +++ P+T++ P H DA+++L V  GRA +T+V  + R+S+ +E+G   +IPAGT  +
Sbjct  101  LAILEANPHTFISPAHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVY 160
Query  145  LVNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEID 204
            ++N ++N+ L I+K+  PV+ P  F+ F+ +  E  +S+ R FS  +LEA++    ++++
Sbjct  161  MINRDENEKLFIVKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLE 220
Query  205  RVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRK-ELSSQDE-PFNLRNSN 262
            +V FGE          Q +G IV+  RE+IR L +H +   R   +  +   P NL + +
Sbjct  221  KV-FGE----------QSKGSIVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKH 269
Query  263  PIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKI 322
            P  SN+FGR YE  P+ + QL+DLD+ +S  ++ +G +  P+YNS+A  I V+ EGE   
Sbjct  270  PSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFF 329
Query  323  ELVGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINAT--SNLNFFAFGINAENN 380
            E+  P   +    S   Q+  A L    VFV PA +PVA+ A+  +NL  + F +NA  N
Sbjct  330  EMACP---HLSSSSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGN 386
Query  381  QRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKG 440
             R  LAG K N+++E   +  +++F     +VE++ K Q ++ F    P +QQ E G  G
Sbjct  387  SRFPLAG-KGNIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPG-PNKQQEEGGRGG 444
Query  441  R 441
            R
Sbjct  445  R 445

Sequence Alignment: 28. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 98.1 bits 403,  Expect = 1e-21
 Identities = 126/397 31%, Positives = 226/397 56%, Gaps = 18/397 4%
Query  27   REHQESQEESDSRGQN-NPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRV 85
            RE  E ++E ++  ++ NP+ F  D  F T  K + G + ++ +F Q+SK ++ LE YR+
Sbjct  132  REDDEDEDEDEAEEEDENPYVFE-DEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRL 190
Query  86   VEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFL 145
              + + P  +++P H DAD ++ V  GR  +T +  + R+S  + QG    I +GT F++
Sbjct  191  AVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYI 250
Query  146  VNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDR 205
             N ++N+ L ++++  PVN P  F+ F     E  +S+ R FS  ILEA++ +    +++
Sbjct  251  ANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK 310
Query  206  VLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDE-PFNLRNSNPI 264
             LF          E Q++G I++  +EQ+R + +  +      ++ +    F L   +P 
Sbjct  311  -LF----------EKQDQGTIMKASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPS 359
Query  265  YSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIEL 324
             SNK+G+ +E      P L+ LD+ +S  ++ +GG+ +P YNS+A  I ++  GE  +E+
Sbjct  360  QSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEI 419
Query  325  VGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGINAENNQR 382
              P     +      ++ RA + +D VF++PA +P A  A+ N N+    F +NAE N R
Sbjct  420  ACPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIR 479
Query  383  NFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEG 437
              LAG+K N++  +  E  +++F   G +V+K+  KQ E  F    PE ++ +EG
Sbjct  480  YTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKEKEG 532

Sequence Alignment: 29. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 98.1 bits 403,  Expect = 1e-21
 Identities = 127/397 31%, Positives = 226/397 56%, Gaps = 18/397 4%
Query  27   REHQESQEESDSRGQN-NPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRV 85
            RE  E ++E ++  ++ NP+ F  D  F T  K + G + ++ +F Q+SK ++ LE YR+
Sbjct  134  REDDEDEDEDEAEEEDENPYVFE-DEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRL 192
Query  86   VEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFL 145
              + + P  +++P H DAD ++ V  GR  +T +  + R+S  + QG    I +GT F++
Sbjct  193  AVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYI 252
Query  146  VNPNDNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDR 205
             N ++N+ L ++++  PVN P  F+ F     E  +S+ R FS  ILEA++ +    +++
Sbjct  253  ANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK 312
Query  206  VLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKELSSQDE-PFNLRNSNPI 264
             LF          E Q++G I++  +EQIR + +  +      ++ +    F L   +P 
Sbjct  313  -LF----------EKQDQGTIMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPS 361
Query  265  YSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIEL 324
             SNK+G+ +E      P L+ LD+ +S  ++ +GG+ +P YNS+A  I ++  GE  +E+
Sbjct  362  QSNKYGQLFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEI 421
Query  325  VGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNF--FAFGINAENNQR 382
              P     +      ++ RA + +D VF++PA +P A  A+ N N+    F +NAE N R
Sbjct  422  ACPHLSSSKSSHPSYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAEGNIR 481
Query  383  NFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEG 437
              LAG+K N++  +  E  +++F   G +V+K+  KQ E  F    PE ++ +EG
Sbjct  482  YTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQG-PEWRKEKEG 534

Sequence Alignment: 30. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 57.3 bits 224,  Expect = 2e-09
 Identities = 117/420 27%, Positives = 214/420 50%, Gaps = 61/420 14%
Query  9    LLGILFLASLSVSFGIVHR----EHQESQ-EESDSRGQNNPFYFNSDRRFHTLFKNQYGH 63
            +L +L+L+S S+   + ++    E +E + EE   R   +   F   RR   ++K   G 
Sbjct  13   ILALLLLSSWSLMVVMAYQGRGMEGREKRVEEKAPRSPEDRGLFIL-RRSKEVLKTDAGE 71
Query  64   LRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDG 123
            +R++  +  R     N     +     +PNTL +P++ DA ++L V  G A +  +  + 
Sbjct  72   VRLMMGYRYRG----NHSPMHIGFITMEPNTLYIPQYIDASLILFVRRGEAKVGYIYKNK 127
Query  124  RDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLAIPVNNPHRF----QNFFLSSTEA 179
                 L+ G+   IPAG++F++VN + ++ L II     + +   +    Q+F++     
Sbjct  128  LVEKRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGGGVL 187
Query  180  QQSYLRGFSKNILEASFDSDFKEIDRVL---FGEERQQQHGEESQEEGV---IVELKREQ 233
             +S L GF  + L A+F+    +++ +L    G    + +GE +++      I++LK   
Sbjct  188  PRSVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERM 247
Query  234  IRE-----------------------LIKH--AKSSSR----KELSSQDEPFNLRNSNPI 264
            ++E                       L+K    K   R     +L+     +NL ++ P 
Sbjct  248  VQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPS 307
Query  265  YSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIEL 324
            Y N +G    I       LK  ++ +  V++K G +L PH N  A    +I  G   I++
Sbjct  308  YQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQV 367
Query  325  VGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSN--LNFFAFGINAENNQR 382
            V P+     +         A++SE DVF IP  +P    A+    L FF F  +A  N+ 
Sbjct  368  VFPNGTAAMN---------AKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRP 418
Query  383  NFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRK 442
             FL G K +++  +    L  +F  S  ++E+++K Q E+  +   P ++  E   K  K
Sbjct  419  QFLVG-KSSLLHSMRGPELAAAFGVSEEQLERIVKAQREAVILPTSPHREMEEINGKKWK 477
Query  443  G 443
            G
Sbjct  478  G 478

Sequence Alignment: 31. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 54.2 bits 210,  Expect = 2e-08
 Identities = 96/370 25%, Positives = 190/370 51%, Gaps = 59/370 15%
Query  34   EESDSRGQNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKS-KP 92
            E  D +   + F  ++  R   +FK   G +RV+     +S   + +  +  + F S +P
Sbjct  26   EGGDKKSPKSLFLMSNSTR---VFKTDAGEMRVL-----KSHGGRIFYRHMHIGFISMEP 77
Query  93   NTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDND 152
             +L++P++ D+++++ +  G A L ++  D      L+ G    IP+G+ F+LVN  +  
Sbjct  78   KSLFVPQYLDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQ 137
Query  153  NLRIIKLAIPVNNP--HRFQNFFLSSTEAQQSYLRGFSKNILEASFDSD-------F-KE 202
             L +I    P  +     FQ+F++      +S L GF   ILE +F+         F KE
Sbjct  138  RLHVICSIDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKE 197
Query  203  IDR-VLF-------------------GEERQQQHGEESQEEGVIVELKREQIRELIKHAK 242
            +D  ++F                    +E+Q +   + QEE    +      R+L++   
Sbjct  198  LDGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVF 257
Query  243  SSSRKELSSQDE---P--FNLRNSNPI-YSNKFGRWYE-ITPEKNPQLKDLDVFISSVDM 295
                +++ ++D    P  +NL +     + N +G W + +   + P L + D+ +  V +
Sbjct  258  GKVNEKIENKDTAGSPASYNLYDDKKADFKNAYG-WSKALHGGEYPPLSEPDIGVLLVKL 316
Query  296  KEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDDVFVIP 355
              G +L PH N  +    ++  G  ++ +  P+  +           + ++ + DVFV+P
Sbjct  317  SAGSMLAPHVNPISDEYTIVLSGYGELHIGYPNGSRAM---------KTKIKQGDVFVVP 367
Query  356  AAYPVAINATSN--LNFFAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVE 413
              +P    A+ +  L FF F  +A  N+  FLAG    + + +  E L  +F  S + + 
Sbjct  368  RYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAASLLRTLMGPE-LSAAFGVSEDTLR 426
Query  414  KLIKKQSES 422
            + +  Q E+
Sbjct  427  RAVDAQHEA 435

Sequence Alignment: 32. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 46.6 bits 177,  Expect = 3e-06
 Identities = 96/350 27%, Positives = 171/350 48%, Gaps = 75/350 21%
Query  70   FDQRSKQIQNLENYRVVEFKSKPNTLLLPHHADADFLLVVLNGRAILTLVNPDGRDSYIL 129
            +DQ + + Q      ++    +P  LLLP  ++A  L+ V  G  I  +  P   ++Y  
Sbjct  72   WDQDNDEFQC-AGVNMIRHTIRPKGLLLPGFSNAPKLIFVAQGFGIRGIAIPGCAETYQT 130
Query  130  E------QGHA-----QKI-----------PAGTTFFLVNPNDNDNLRIIKLAIPVN--- 164
            +       G A     QKI           PAG + ++ N   +D L +I +A   N   
Sbjct  131  DLRRSQSAGSAFKDQHQKIRPFREGDLLVVPAGVSHWMYNRGQSD-LVLIVFADTRNVAN 189
Query  165  --NPHRFQNFFL---------------------SSTEAQQSYLRGFSKNILEASFDSDFK 201
              +P+ ++ F+L                     SS E   + + GF+   LE +F  D  
Sbjct  190  QIDPY-LRKFYLAGRPEQVERGVEEWERSSRKGSSGEKSGNIFSGFADEFLEEAFQIDGG 248
Query  202  EIDRVLFGEERQQQHGEESQEE-GVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLR- 259
             + R L GE+ ++    +  E+  V++  K E+ R   ++ +S S  E   ++    LR 
Sbjct  249  LV-RKLKGEDDERDRIVQVDEDFEVLLPEKDEEERSRGRYIESESESENGLEETICTLRL 307
Query  260  NSN-------PIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVI 312
              N        +++ + GR         P L+ + +      +    ++ PHY   +  +
Sbjct  308  KQNIGRSVRADVFNPRGGRISTANYHTLPILRQVRLSAERGVLYSNAMVAPHYTVNSHSV 367
Query  313  LVINEGEAKIELVGPSDQQQQDESLEVQRYRAELSEDDVFVIPAAYPVAINATSNLNF-- 370
            +    G A++++V    Q   D          E+ E  V++IP  + V I   S+  F  
Sbjct  368  MYATRGNARVQVVDNFGQSVFD---------GEVREGQVLMIPQNF-VVIKRASDRGFEW 417
Query  371  FAFGINAENNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPE 430
             AF  N +N   N+LAG + + M  +P  VL   +  S  + ++L   Q E   +     
Sbjct  418  IAFKTN-DNAITNLLAG-RVSQMRMLPLGVLSNMYRISREEAQRLKYGQQEMRVLSPGRS 475
Query  431  QQQRE 435
            Q +RE
Sbjct  476  QGRRE 480

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.