The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGV
AAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL
HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA
QEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV
QIVNARQ
Sequence Info Allergen Name Length Opt Bits Score E Value
AIO08860 Der f 25.0201 247 1619 375.7 7.8e-106
QAT18637 Der p 25.0101 247 1500 348.6 1.1e-97
L7UZA7 Der f 25.0101 247 1415 329.2 7.7e-92
XP_026795867 Pan h 8.0101 248 1184 276.6 5.5e-76
A0A1L5YRA2 Scy p 8.0101 248 1160 271.1 2.4e-74
ACM09737 Sal s 8.01 247 1156 270.2 4.6e-74
F5A6E97 Pro c 8.0101 248 1134 265.2 1.5e-72
Q8T5G9 Arc s 8.0101 224 1022 239.7 6.3e-65
CAC14917 Tri a TPIS 253 989 232.1 1.4e-62
CAC14917 Tri a 31.0101 253 989 232.1 1.4e-62
Q0CJH1 Asp t 36.0101 249 929 218.4 1.7e-58
F8QN77 Pen m 8.0101 266 906 213.2 7.2e-57
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 25.0201 Sequence ID: AIO08860

 Score = 375.7 bits 1619,  Expect = 8e-106
 Identities = 247/247 100%, Positives = 247/247 100%, Gaps = 0/247 0%
Query  1    MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGV 60
            MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGV
Sbjct  1    MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGV 60
Query  61   AAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
            AAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL
Sbjct  61   AAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
Query  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
            HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA
Sbjct  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
Query  181  QEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV 240
            QEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV
Sbjct  181  QEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV 240
Query  241  QIVNARQ 247
            QIVNARQ
Sbjct  241  QIVNARQ 247

Sequence Alignment: 2. Allergen Name: Der p 25.0101 Sequence ID: QAT18637

 Score = 348.6 bits 1500,  Expect = 1e-97
 Identities = 227/247 91%, Positives = 240/247 97%, Gaps = 0/247 0%
Query  1    MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGV 60
            M RKFFVGGNWKMNGSRATN+DLIK L+N PLDPNT+VVVGVPSIY+A+VR+KL K+IGV
Sbjct  1    MGRKFFVGGNWKMNGSRATNDDLIKILTNTPLDPNTEVVVGVPSIYLADVRHKLSKSIGV 60
Query  61   AAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
            AAQNCYKV KGAFTGEISPAMIKDVGAEWVILGHSERRNVFGE+DQLIGEKVEHAL EGL
Sbjct  61   AAQNCYKVAKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGENDQLIGEKVEHALNEGL 120
Query  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
            +VIACIGEL+EEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA
Sbjct  121  NVIACIGELFEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
Query  181  QEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV 240
            QEVHQ+LRQWFS N+SPQIAETIRIIYGGSVTA+NAKELASQADVDGFLVGGASLKPEFV
Sbjct  181  QEVHQQLRQWFSTNISPQIAETIRIIYGGSVTASNAKELASQADVDGFLVGGASLKPEFV 240
Query  241  QIVNARQ 247
            QIVNARQ
Sbjct  241  QIVNARQ 247

Sequence Alignment: 3. Allergen Name: Der f 25.0101 Sequence ID: L7UZA7

 Score = 329.2 bits 1415,  Expect = 8e-92
 Identities = 217/247 87%, Positives = 227/247 91%, Gaps = 0/247 0%
Query  1    MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGV 60
            M RKFFVGGNWKMNG++   ++++  L NGPLD N +VVVGVP+IY+   +  LP  I V
Sbjct  1    MGRKFFVGGNWKMNGNKTAIKEIVDFLKNGPLDSNVEVVVGVPAIYLMLCKNILPDNIRV 60
Query  61   AAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
            AAQNCYKV KGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL
Sbjct  61   AAQNCYKVDKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
Query  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
            HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDW KVVLAYEPVWAIGTGKTASPQQA
Sbjct  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWFKVVLAYEPVWAIGTGKTASPQQA 180
Query  181  QEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV 240
            QEVHQKLRQ FSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV
Sbjct  181  QEVHQKLRQCFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV 240
Query  241  QIVNARQ 247
            QIVNARQ
Sbjct  241  QIVNARQ 247

Sequence Alignment: 4. Allergen Name: Pan h 8.0101 Sequence ID: XP_026795867

 Score = 276.6 bits 1184,  Expect = 6e-76
 Identities = 177/244 72%, Positives = 204/244 83%, Gaps = 0/244 0%
Query  3    RKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGVAA 62
            RKFFVGGNWKMNG + +  +LI TL++  L+ +T+VV G PSIY+   R KL   IGVAA
Sbjct  4    RKFFVGGNWKMNGDKKSLGELINTLNSATLNADTEVVCGAPSIYLDFARSKLDAKIGVAA 63
Query  63   QNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGLHV 122
            QNCYKV KGAFTGEISPAMIKD G EWVILGHSERR+VFGESD+LIG+KV HAL+ GL V
Sbjct  64   QNCYKVAKGAFTGEISPAMIKDCGVEWVILGHSERRHVFGESDELIGQKVAHALETGLGV 123
Query  123  IACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQE 182
            IACIGE L+EREAG T +VVF QT+ I+ +VKDWSKVV+AYEPVWAIGTGKTASPQQAQE
Sbjct  124  IACIGEKLDEREAGITEKVVFAQTKAIADNVKDWSKVVVAYEPVWAIGTGKTASPQQAQE 183
Query  183  VHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFVQI 242
            VH KLRQW S N+S  +A ++RIIYGGSVT    KELA+Q DVDGFLVGGASLKPEFV+I
Sbjct  184  VHDKLRQWISANISEAVANSVRIIYGGSVTGATCKELAAQKDVDGFLVGGASLKPEFVEI 243
Query  243  VNAR 246
            +NA+
Sbjct  244  INAK 247

Sequence Alignment: 5. Allergen Name: Scy p 8.0101 Sequence ID: A0A1L5YRA2

 Score = 271.1 bits 1160,  Expect = 2e-74
 Identities = 168/243 69%, Positives = 198/243 81%, Gaps = 1/243 0%
Query  3    RKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGVAA 62
            RKFFVGGNWKMNG +A  + +I  +  GPL+ +T+VVVG P  Y+   R+ +P  IGVAA
Sbjct  5    RKFFVGGNWKMNGDKAAIDGIISFMK-GPLNADTEVVVGCPQCYLMYTREHMPANIGVAA 63
Query  63   QNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGLHV 122
            QNCYK  KGAFTGEISPAMIKD G EWVILGHSERRNVFGE DQLI EKV HAL+ GL V
Sbjct  64   QNCYKTAKGAFTGEISPAMIKDCGCEWVILGHSERRNVFGEPDQLISEKVGHALEAGLKV 123
Query  123  IACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQE 182
            I CIGE LEERE+ +T EVVF Q + +  ++ DWS+VV+AYEPVWAIGTGKTA+P+QAQ+
Sbjct  124  IPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQD 183
Query  183  VHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFVQI 242
            VH KLRQW+ +NVSPQ+AE+ RIIYGGSV+A N KELA   D+DGFLVGGASLKP+FV I
Sbjct  184  VHAKLRQWLRDNVSPQVAESTRIIYGGSVSAGNCKELAKTGDIDGFLVGGASLKPDFVTI 243
Query  243  VNAR 246
            +NAR
Sbjct  244  INAR 247

Sequence Alignment: 6. Allergen Name: Sal s 8.01 Sequence ID: ACM09737

 Score = 270.2 bits 1156,  Expect = 5e-74
 Identities = 173/247 70%, Positives = 198/247 80%, Gaps = 0/247 0%
Query  1    MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGV 60
            M RKFFVGGNWKMNG +A+  +LIKTL++  LDPNT+VV G PSIY+   R KL   IGV
Sbjct  1    MSRKFFVGGNWKMNGDKASLGELIKTLNSAKLDPNTEVVCGAPSIYLEFARSKLDPKIGV 60
Query  61   AAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
            AAQNCYKV  GAFTGEISPAMIKDVG  WVILGHSERR VFGE+D+LIG+K  HAL+ GL
Sbjct  61   AAQNCYKVKGGAFTGEISPAMIKDVGVHWVILGHSERRWVFGETDELIGQKCAHALENGL 120
Query  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQA 180
             VIACIGE L+EREAG T +V+  QT+  + ++KDWSKVVLAYEPVWAIGTGKTASP QA
Sbjct  121  GVIACIGEKLDEREAGITEKVINAQTKHFADNIKDWSKVVLAYEPVWAIGTGKTASPAQA 180
Query  181  QEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFV 240
            Q+VH KLRQW   NVS  +A ++RIIYGGSVT    KEL    DVDGFLVGGA+LKPEFV
Sbjct  181  QDVHDKLRQWVKANVSEAVANSVRIIYGGSVTGGTCKELGGMKDVDGFLVGGAALKPEFV 240
Query  241  QIVNARQ 247
             I+NA+Q
Sbjct  241  DIINAKQ 247

Sequence Alignment: 7. Allergen Name: Pro c 8.0101 Sequence ID: F5A6E97

 Score = 265.2 bits 1134,  Expect = 1e-72
 Identities = 166/243 68%, Positives = 195/243 80%, Gaps = 1/243 0%
Query  3    RKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGVAA 62
            RKFFVGGNWKMNG RA  + +I  +  GPL  +T+VVVG P  Y+   R+ LP  IGVAA
Sbjct  5    RKFFVGGNWKMNGDRAGIDSIISFMK-GPLSADTEVVVGCPQCYLMYTREHLPSNIGVAA 63
Query  63   QNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGLHV 122
            QNCYKV KGAFTGEISP+MIKD G EWVILGHSERRNVF E D LI EKV HAL+ GL V
Sbjct  64   QNCYKVAKGAFTGEISPSMIKDCGCEWVILGHSERRNVFNEPDTLISEKVGHALEAGLKV 123
Query  123  IACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQE 182
            I CIGE LEERE+ +T EVVF Q + +  ++ DWS+VV+AYEPVWAIGTGKTA+P+QAQE
Sbjct  124  IPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQE 183
Query  183  VHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFVQI 242
            VH KLRQW+ +NV+ ++A++ RIIYGGSVT  N KELA   D+DGFLVGGASLKP+FVQI
Sbjct  184  VHAKLRQWLRDNVNAEVADSTRIIYGGSVTPGNCKELAKTGDIDGFLVGGASLKPDFVQI 243
Query  243  VNAR 246
            +NAR
Sbjct  244  INAR 247

Sequence Alignment: 8. Allergen Name: Arc s 8.0101 Sequence ID: Q8T5G9

 Score = 239.7 bits 1022,  Expect = 6e-65
 Identities = 149/224 66%, Positives = 177/224 79%, Gaps = 1/224 0%
Query  8    GGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGVAAQNCYK 67
            GGNWKMNG RA+ + +I  +  GPL  +T+VVVG P  Y+   R+ LP  IGVAAQNCYK
Sbjct  1    GGNWKMNGDRASIDSIISFMK-GPLSGDTEVVVGCPQCYLMYTREHLPSNIGVAAQNCYK 59
Query  68   VPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGLHVIACIG 127
            V KGAFTGEISP+MIKD G EWVILGHSERRNVF E D LI EKV HAL+ GL VI CIG
Sbjct  60   VAKGAFTGEISPSMIKDCGCEWVILGHSERRNVFNEPDTLISEKVGHALEAGLKVIPCIG 119
Query  128  ELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQEVHQKL 187
            E LEERE+ +T EVVF Q + +  ++ DWS+VV+AYEPVWAIGTGKTA+P+QAQEVH KL
Sbjct  120  EKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQEVHAKL 179
Query  188  RQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGG 232
            RQW+ +NV+ ++A++ RIIYGGSVT  N KELA   D+DGFLVGG
Sbjct  180  RQWLRDNVNAEVADSTRIIYGGSVTPGNCKELAKTGDIDGFLVGG 224

Sequence Alignment: 9. Allergen Name: Tri a TPIS Sequence ID: CAC14917

 Score = 232.1 bits 989,  Expect = 1e-62
 Identities = 149/244 61%, Positives = 186/244 76%, Gaps = 4/244 1%
Query  1    MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVV---VGVPSIYMAEVRQKLPKT 57
            M RKFFVGGNWK NG+    E ++ TL+ G +  +TDVV   V  P +++  V+ KL   
Sbjct  1    MGRKFFVGGNWKCNGTVEQVESIVNTLNAGQI-ASTDVVEVVVSPPYVFLPTVKGKLRPE 59
Query  58   IGVAAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQ 117
            I VAAQNC+    GAFTGE+S  M+ ++G  WVILGHSERR++ GES +++GEKV +AL 
Sbjct  60   IQVAAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSEFVGEKVAYALA 119
Query  118  EGLHVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASP 177
            +GL VIAC+GE LE+REAG T  VV  QT+ I+  +KDW+ VV+AYEPVWAIGTGK ASP
Sbjct  120  QGLKVIACVGETLEQREAGSTMAVVAEQTKAIADKIKDWTNVVVAYEPVWAIGTGKVASP 179
Query  178  QQAQEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKP 237
             QAQEVH  LR W+  NVSP++AE+ RIIYGGSVT  + KELA+Q DVDGFLVGGASLKP
Sbjct  180  AQAQEVHANLRDWLKTNVSPEVAESTRIIYGGSVTGASCKELAAQPDVDGFLVGGASLKP 239
Query  238  EFVQIVNA 245
            EF+ I+NA
Sbjct  240  EFIDIINA 247

Sequence Alignment: 10. Allergen Name: Tri a 31.0101 Sequence ID: CAC14917

 Score = 232.1 bits 989,  Expect = 1e-62
 Identities = 149/244 61%, Positives = 186/244 76%, Gaps = 4/244 1%
Query  1    MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVV---VGVPSIYMAEVRQKLPKT 57
            M RKFFVGGNWK NG+    E ++ TL+ G +  +TDVV   V  P +++  V+ KL   
Sbjct  1    MGRKFFVGGNWKCNGTVEQVESIVNTLNAGQI-ASTDVVEVVVSPPYVFLPTVKGKLRPE 59
Query  58   IGVAAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQ 117
            I VAAQNC+    GAFTGE+S  M+ ++G  WVILGHSERR++ GES +++GEKV +AL 
Sbjct  60   IQVAAQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSEFVGEKVAYALA 119
Query  118  EGLHVIACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASP 177
            +GL VIAC+GE LE+REAG T  VV  QT+ I+  +KDW+ VV+AYEPVWAIGTGK ASP
Sbjct  120  QGLKVIACVGETLEQREAGSTMAVVAEQTKAIADKIKDWTNVVVAYEPVWAIGTGKVASP 179
Query  178  QQAQEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKP 237
             QAQEVH  LR W+  NVSP++AE+ RIIYGGSVT  + KELA+Q DVDGFLVGGASLKP
Sbjct  180  AQAQEVHANLRDWLKTNVSPEVAESTRIIYGGSVTGASCKELAAQPDVDGFLVGGASLKP 239
Query  238  EFVQIVNA 245
            EF+ I+NA
Sbjct  240  EFIDIINA 247

Sequence Alignment: 11. Allergen Name: Asp t 36.0101 Sequence ID: Q0CJH1

 Score = 218.4 bits 929,  Expect = 2e-58
 Identities = 135/246 54%, Positives = 184/246 74%, Gaps = 2/246 0%
Query  1    MVRKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGV 60
            M R+FFVGGN+KMNG+  +   +IK L++  LD +++VV+  P++Y+   R+     IGV
Sbjct  1    MPRQFFVGGNFKMNGTADSITSIIKNLNDAKLDSSSEVVISPPALYLLLAREVANSNIGV 60
Query  61   AAQNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGL 120
            AAQN +  P GAFTGEIS   ++D   +W ++GHSERR ++ ESD++I  KV+ A+  G+
Sbjct  61   AAQNVFDKPNGAFTGEISVEQLRDAKIDWTLIGHSERRVILKESDEFIARKVKAAIDGGV 120
Query  121  HVIACIGELLEEREAGKTTEVVFRQTQVISKHV--KDWSKVVLAYEPVWAIGTGKTASPQ 178
             VI CIGE LEEREAGKT +VV RQ   ++K +  + W+KVV+AYEPVWAIGTGK A+ +
Sbjct  121  SVIFCIGETLEEREAGKTIDVVTRQLNAVAKELSKEQWAKVVIAYEPVWAIGTGKVATTE 180
Query  179  QAQEVHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPE 238
            QAQEVH  +R+W++E +SP++++  RIIYGGSV+  N +ELA Q DVDGFLVGGASLKP 
Sbjct  181  QAQEVHAAIRKWLTETISPEVSDNTRIIYGGSVSEKNCRELAKQPDVDGFLVGGASLKPA 240
Query  239  FVQIVNAR 246
            FV I+NAR
Sbjct  241  FVDIINAR 248

Sequence Alignment: 12. Allergen Name: Pen m 8.0101 Sequence ID: F8QN77

 Score = 213.2 bits 906,  Expect = 7e-57
 Identities = 127/245 51%, Positives = 176/245 71%, Gaps = 0/245 0%
Query  3    RKFFVGGNWKMNGSRATNEDLIKTLSNGPLDPNTDVVVGVPSIYMAEVRQKLPKTIGVAA 62
            RKFFV GNWKMN  +     ++K ++N  LD NT+ VVG PS Y++  R+ L   IG+AA
Sbjct  5    RKFFVIGNWKMNVDKNRINGIVKMMNNAALDANTEAVVGCPSCYLSYAREHLTHNIGIAA 64
Query  63   QNCYKVPKGAFTGEISPAMIKDVGAEWVILGHSERRNVFGESDQLIGEKVEHALQEGLHV 122
            QNCYKV +G F+GEISP MIKD G +WVILGH ERR VF E D +I EKV HA + G+ +
Sbjct  65   QNCYKVARGNFSGEISPEMIKDCGCDWVILGHPERRTVFNEPDSFIAEKVAHAQEAGMKI 124
Query  123  IACIGELLEEREAGKTTEVVFRQTQVISKHVKDWSKVVLAYEPVWAIGTGKTASPQQAQE 182
            IAC+ E  ++R+ G+T EV+F+Q   ++  + DWS+VVLA+E +WA  TG  A+ QQ Q+
Sbjct  125  IACLCETTDDRQKGRTEEVLFKQLTSLAAAITDWSRVVLAFEALWASNTGVFATNQQVQD 184
Query  183  VHQKLRQWFSENVSPQIAETIRIIYGGSVTANNAKELASQADVDGFLVGGASLKPEFVQI 242
                +R W+  NVS ++A+T R+IY GSV+++N +E+AS  ++DGFLVGGASLKP+ V I
Sbjct  185  ALGLVRNWLRNNVSDKVADTTRLIYAGSVSSDNCREMASLENLDGFLVGGASLKPDIVDI 244
Query  243  VNARQ 247
            +N+R+
Sbjct  245  INSRR 249

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.