The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MVYCTASLPLLLLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTC
QSQCGGVTPSPGGGVASLISQSVFNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASV
GDTATRKREIAAFLAQTSHETTGGWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAP
GKKYYGRGPIQISYNYNYGPAGRAIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPS
CHNVITGRWTPSAADRAAGRLPGYGVITNIINGGIECGKGFNDKVADRIGFYKRYCDLLG
VSYGSNLDCYNQRSFGVSTNPLAASS
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB01591 Pers a 1 326 2328 530.4 3.8e-152
Q8VXF1 Mus a 2.0101 318 1800 411.7 2e-116
Q42428 Cas s 5 316 1568 359.6 9.6e-101
CAC42881 Hev b 11.0101 295 1550 355.6 1.4e-99
CAD24068 Hev b 11.0102 295 1545 354.4 3.2e-99
P29022 Zea m 8.0101 280 484 116.0 1.8e-27
P02877 Hev b 6.01 204 296 73.9 6.1e-15
P0DKH8 Fag e 4.0102 40 252 64.9 6.1e-13
Exo m 1.0101 40 252
AAA34256 Tri a 18 212 206 53.7 7.9e-09
AAA34257 Tri a 18 186 204 53.3 9e-09
AAA34258 Tri a 18 213 203 53.0 1.3e-08
P81729 Bra r 2 91 176 47.4 2.6e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pers a 1 Sequence ID: CAB01591

 Score = 530.4 bits 2328,  Expect = 4e-152
 Identities = 326/326 100%, Positives = 326/326 100%, Gaps = 0/326 0%
Query  1    MVYCTASLPLLLLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTC 60
            MVYCTASLPLLLLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTC
Sbjct  1    MVYCTASLPLLLLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTC 60
Query  61   QSQCGGVTPSPGGGVASLISQSVFNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASV 120
            QSQCGGVTPSPGGGVASLISQSVFNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASV
Sbjct  61   QSQCGGVTPSPGGGVASLISQSVFNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASV 120
Query  121  GDTATRKREIAAFLAQTSHETTGGWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAP 180
            GDTATRKREIAAFLAQTSHETTGGWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAP
Sbjct  121  GDTATRKREIAAFLAQTSHETTGGWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAP 180
Query  181  GKKYYGRGPIQISYNYNYGPAGRAIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPS 240
            GKKYYGRGPIQISYNYNYGPAGRAIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPS
Sbjct  181  GKKYYGRGPIQISYNYNYGPAGRAIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPS 240
Query  241  CHNVITGRWTPSAADRAAGRLPGYGVITNIINGGIECGKGFNDKVADRIGFYKRYCDLLG 300
            CHNVITGRWTPSAADRAAGRLPGYGVITNIINGGIECGKGFNDKVADRIGFYKRYCDLLG
Sbjct  241  CHNVITGRWTPSAADRAAGRLPGYGVITNIINGGIECGKGFNDKVADRIGFYKRYCDLLG 300
Query  301  VSYGSNLDCYNQRSFGVSTNPLAASS 326
            VSYGSNLDCYNQRSFGVSTNPLAASS
Sbjct  301  VSYGSNLDCYNQRSFGVSTNPLAASS 326

Sequence Alignment: 2. Allergen Name: Mus a 2.0101 Sequence ID: Q8VXF1

 Score = 411.7 bits 1800,  Expect = 2e-116
 Identities = 246/304 80%, Positives = 267/304 87%, Gaps = 2/304 0%
Query  12   LLLLVGLLAGE--AFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQCGGVTP 69
            LLL++  LA    AFAEQCGRQAGGALCPGGLCCSQ+GWCG+T  YCG  CQSQCGG   
Sbjct  4    LLLVIFTLASSLGAFAEQCGRQAGGALCPGGLCCSQYGWCGNTDPYCGQGCQSQCGGSGG 63
Query  70   SPGGGVASLISQSVFNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASVGDTATRKRE 129
            S GG VAS+IS S+F QMLKHRNDAAC  KGFYTYNAFIAAANSF+GF + GD A +KRE
Sbjct  64   SGGGSVASIISSSLFEQMLKHRNDAACPGKGFYTYNAFIAAANSFSGFGTTGDDAKKKRE 123
Query  130  IAAFLAQTSHETTGGWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAPGKKYYGRGP 189
            IAAFLAQTSHETTGGWATAPDGPYAWGYCF++EQ    DYCV ++QWPCA GKKYYGRGP
Sbjct  124  IAAFLAQTSHETTGGWATAPDGPYAWGYCFVQEQNPSSDYCVASSQWPCAAGKKYYGRGP 183
Query  190  IQISYNYNYGPAGRAIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPSCHNVITGRW 249
            IQIS+NYNYGPAGRAIG DL+NNPD VATD  ISFKTALWFWMTPQSPKPSCH+VITG W
Sbjct  184  IQISFNYNYGPAGRAIGSDLLNNPDLVATDATISFKTALWFWMTPQSPKPSCHDVITGSW 243
Query  250  TPSAADRAAGRLPGYGVITNIINGGIECGKGFNDKVADRIGFYKRYCDLLGVSYGSNLDC 309
            TPS AD+AAGRLPGYGV TNIINGG+ECGKG++ +VADRIGFYKRYCDLLGVSYG NLDC
Sbjct  244  TPSNADQAAGRLPGYGVTTNIINGGLECGKGYDARVADRIGFYKRYCDLLGVSYGDNLDC 303
Query  310  YNQRSF 315
            YNQR F
Sbjct  304  YNQRPF 309

Sequence Alignment: 3. Allergen Name: Cas s 5 Sequence ID: Q42428

 Score = 359.6 bits 1568,  Expect = 1e-100
 Identities = 219/301 72%, Positives = 252/301 83%, Gaps = 12/301 3%
Query  12   LLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQCGG---VT 68
            LLL++ +L G + AEQCGRQAGGA C   LCCSQFGWCG+T++YCG  CQSQC      T
Sbjct  6    LLLFLAFLLGTS-AEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQCSSPTTTT 64
Query  69   PSP------GGGVASLISQSVFNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASVGD 122
             SP      GG V SLIS S+F+QMLK+RND  C++ GFYTYNAFIAAA SFNGF + GD
Sbjct  65   SSPTASSGGGGDVGSLISASLFDQMLKYRNDPRCKSNGFYTYNAFIAAARSFNGFGTTGD 124
Query  123  TATRKREIAAFLAQTSHETTGGWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAPGK 182
              TRKRE+AAFLAQTSHETTGGWATAPDGPYAWGYCF+ E  N   YC  +  WPC  GK
Sbjct  125  VTTRKRELAAFLAQTSHETTGGWATAPDGPYAWGYCFVMEN-NKQTYCT-SKSWPCVFGK 182
Query  183  KYYGRGPIQISYNYNYGPAGRAIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPSCH 242
            +YYGRGPIQ+++NYNYG AG+AIG DLINNPD VAT+P ISFKTA+WFWMTPQ+ KPS H
Sbjct  183  QYYGRGPIQLTHNYNYGQAGKAIGADLINNPDLVATNPTISFKTAIWFWMTPQANKPSSH 242
Query  243  NVITGRWTPSAADRAAGRLPGYGVITNIINGGIECGKGFNDKVADRIGFYKRYCDLLGVS 302
            +VI G W PSAAD +AGR+P YGVITNIINGG+ECG G +D+VA+RIGFYKRYCD LGVS
Sbjct  243  DVIIGNWRPSAADTSAGRVPSYGVITNIINGGLECGHGSDDRVANRIGFYKRYCDTLGVS 302
Query  303  YGSNLDCYNQRSF 315
            YG+NLDCYNQ+ F
Sbjct  303  YGNNLDCYNQKPF 315

Sequence Alignment: 4. Allergen Name: Hev b 11.0101 Sequence ID: CAC42881

 Score = 355.6 bits 1550,  Expect = 1e-99
 Identities = 204/292 69%, Positives = 239/292 81%, Gaps = 2/292 0%
Query  26   EQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQCGGVTPSPGGGV--ASLISQSV 83
            EQCGRQAGGALCPGGLCCSQ+GWC +T +YCG  CQSQC G      GG+   S+IS+S 
Sbjct  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGGGGEDGGIDLGSIISRST 60
Query  84   FNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASVGDTATRKREIAAFLAQTSHETTG 143
            F +MLKHRNDAAC AKGFYTY+AFI+AA +F  F + GD  T KREIAAF+ QTSH TTG
Sbjct  61   FEEMLKHRNDAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG 120
Query  144  GWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAPGKKYYGRGPIQISYNYNYGPAGR 203
            GW TAPDGPYAWGYC+ +E      YC P+  +PCAPGKKYYGRGPIQ+S+NYNYG  G+
Sbjct  121  GWPTAPDGPYAWGYCYKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ 180
Query  204  AIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPSCHNVITGRWTPSAADRAAGRLPG 263
            A+G DL+NNPD VATD VISFK A+WFWMTPQ PKPSCH+VITG+W+P+  D +AGR PG
Sbjct  181  ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG 240
Query  264  YGVITNIINGGIECGKGFNDKVADRIGFYKRYCDLLGVSYGSNLDCYNQRSFGV 317
            YGVITNIINGG+ECG+G++ +V DRIGFYKRYCD++ V YGSNLDCYNQ  FG+
Sbjct  241  YGVITNIINGGLECGRGWDARVEDRIGFYKRYCDMFAVGYGSNLDCYNQTPFGL 294

Sequence Alignment: 5. Allergen Name: Hev b 11.0102 Sequence ID: CAD24068

 Score = 354.4 bits 1545,  Expect = 3e-99
 Identities = 205/292 70%, Positives = 238/292 81%, Gaps = 2/292 0%
Query  26   EQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQCGGVTPSPGGGV--ASLISQSV 83
            EQCGRQAGGALCPGGLCCSQ+GWC +T +YCG  CQSQC G     GG V   S+IS+S 
Sbjct  1    EQCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQCDGGVGGEGGCVDLGSIISRST 60
Query  84   FNQMLKHRNDAACQAKGFYTYNAFIAAANSFNGFASVGDTATRKREIAAFLAQTSHETTG 143
            F +MLKHRN+AAC AKGFYTY+AFI+AA +F  F + GD  T KREIAAF+ QTSH TTG
Sbjct  61   FEEMLKHRNNAACPAKGFYTYDAFISAAKAFPAFGTTGDVDTCKREIAAFFGQTSHATTG 120
Query  144  GWATAPDGPYAWGYCFLKEQGNPPDYCVPTAQWPCAPGKKYYGRGPIQISYNYNYGPAGR 203
            GW TAPDGPYAWGYC  +E      YC P+  +PCAPGKKYYGRGPIQ+S+NYNYG  G+
Sbjct  121  GWPTAPDGPYAWGYCHKEELNQASSYCSPSPAYPCAPGKKYYGRGPIQLSWNYNYGQCGQ 180
Query  204  AIGYDLINNPDAVATDPVISFKTALWFWMTPQSPKPSCHNVITGRWTPSAADRAAGRLPG 263
            A+G DL+NNPD VATD VISFK A+WFWMTPQ PKPSCH+VITG+W+P+  D +AGR PG
Sbjct  181  ALGLDLLNNPDLVATDRVISFKAAIWFWMTPQFPKPSCHDVITGQWSPTGHDISAGRAPG 240
Query  264  YGVITNIINGGIECGKGFNDKVADRIGFYKRYCDLLGVSYGSNLDCYNQRSFGV 317
            YGVITNIINGG+ECG G++ +V DRIGFYKRYCD++GV YGSNLDCYNQ  FG+
Sbjct  241  YGVITNIINGGLECGSGWDARVEDRIGFYKRYCDMFGVGYGSNLDCYNQTPFGL 294

Sequence Alignment: 6. Allergen Name: Zea m 8.0101 Sequence ID: P29022

 Score = 116.0 bits 484,  Expect = 2e-27
 Identities = 129/260 49%, Positives = 174/260 66%, Gaps = 55/260 21%
Query  8    LPLLLLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQS-QC-- 64
            L L LL L+   AG A A+ CG       C   +CCS+FG+CG+T  YCG  CQS  C  
Sbjct  8    LALGLLALLCAAAGPAAAQNCG-------CQPNFCCSKFGYCGTTDAYCGDGCQSGPCRS 60
Query  65   GGVTPSPGGG---------VASLISQSVFNQMLKHRNDAACQAKGFYTYNAFIAAANSFN 115
            GG     GGG         VA++++ + FN + K++  + C+ K FYT +AF++A N++ 
Sbjct  61   GGGGGGGGGGGGGGSGGANVANVVTDAFFNGI-KNQAGSGCEGKNFYTRSAFLSAVNAYP 119
Query  116  GFASVGDTATRKREIAAFLAQTSHETTGGWATAPDGPYAWGYCFLKEQGNPPDYC-VPTA 174
            GFA  G     KREIAAF+A+ +HET               +C++ E      YC     
Sbjct  120  GFAHGGTEVEGKREIAAFFAHVTHETGH-------------FCYISEINKSNAYCDASNR 166
Query  175  QWPCAPGKKYYGRGPIQISYNYNYGPAGRAIGYDLINNPDAVATDPVISFKTALWFWMTP 234
            QWPCA G+KYYGRGP+QIS+NYNYGPAGR IG++ + +P+ VA D VI+FKTALWFWM  
Sbjct  167  QWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQDAVIAFKTALWFWMN- 225
Query  235  QSPKPSCHNVITGRWTPSAADRAAGRLPGYGVITNIINGGIECGKGFNDKVADRIGFYKR 294
                 + H V+     P           G+G     ING +EC      ++  R+G+YK+
Sbjct  226  -----NVHGVM-----PQ----------GFGATIRAINGALECNGNNPAQMNARVGYYKQ 265
Query  295  YCDLLGVSYGSNLDC 309
            YC  L V  G NL C
Sbjct  266  YCQQLRVDPGPNLIC 280

Sequence Alignment: 7. Allergen Name: Hev b 6.01 Sequence ID: P02877

 Score = 73.9 bits 296,  Expect = 6e-15
 Identities = 41/75 54%, Positives = 52/75 69%, Gaps = 4/75 5%
Query  11   LLLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGP--TCQSQCGGVT 68
            ++++++  L G A AEQCGRQAGG LCP  LCCSQ+GWCGST +YC P   CQS C    
Sbjct  3    IFIVVLLCLTGVAIAEQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKDSG 62
Query  69   PSPGGGVAS--LISQSVFN 85
               GGG AS  L +  ++N
Sbjct  63   EGVGGGSASNVLATYHLYN 81

Sequence Alignment: 8. Allergen Name: Fag e 4.0102 Sequence ID: P0DKH8

 Score = 64.9 bits 252,  Expect = 6e-13
 Identities = 29/38 76%, Positives = 30/38 78%, Gaps = 0/38 0%
Query  27   QCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQC 64
            QCG Q GGA CPGGLCCSQ+GWCGST  YCG  CQS C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39

Sequence Alignment: 9. Allergen Name: Exo Sequence ID:

 Score = 64.9 bits 252,  Expect = 6e-13
 Identities = 29/38 76%, Positives = 30/38 78%, Gaps = 0/38 0%
Query  27   QCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQC 64
            QCG Q GGA CPGGLCCSQ+GWCGST  YCG  CQS C
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39

Sequence Alignment: 10. Allergen Name: Tri a 18 Sequence ID: AAA34256

 Score = 53.7 bits 206,  Expect = 8e-09
 Identities = 30/55 54%, Positives = 36/55 65%, Gaps = 4/55 7%
Query  17   GLLAGEAFAE-QCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQS-QCGGVTPSPGG 73
            G   G   A+ +CG QAGG LCP  LCCSQ+G+CG  S++CG  CQS  C   T  P G
Sbjct  103  GCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACS--TDKPCG 159
 Score = 51.4 bits 196,  Expect = 4e-08
 Identities = 31/73 42%, Positives = 42/73 57%, Gaps = 11/73 15%
Query  5    TASLPLLLLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQS-- 62
            T +L L    ++ + A  A A++CG Q     CP  LCCSQ+G+CG   DYCG  CQ+  
Sbjct  6    TRALALGAAAVLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGA 65
Query  63   -----QCGGVTPSPGGGVASLISQ 81
                 +CG    S  GG     +Q
Sbjct  66   CWTSKRCG----SQAGGATCTNNQ 85
 Score = 40.6 bits 148,  Expect = 7e-05
 Identities = 19/38 50%, Positives = 23/38 60%, Gaps = 1/38 2%
Query  30   RQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQ-CGGV 67
            + AGG +C    CCS++G CG    YCG  CQS  C GV
Sbjct  160  KDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGV 198

Sequence Alignment: 11. Allergen Name: Tri a 18 Sequence ID: AAA34257

 Score = 53.3 bits 204,  Expect = 9e-09
 Identities = 29/55 52%, Positives = 36/55 65%, Gaps = 4/55 7%
Query  17   GLLAGEAFAE-QCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQS-QCGGVTPSPGG 73
            G   G   A+ +CG QAGG LCP  LCCSQ+G+CG  S++CG  CQ+  C   T  P G
Sbjct  77   GCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACS--TDKPCG 133
 Score = 49.5 bits 187,  Expect = 1e-07
 Identities = 20/37 54%, Positives = 25/37 67%, Gaps = 0/37 0%
Query  26   EQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQS 62
            ++CG Q  G  CP  LCCSQ+G+CG   DYCG  CQ+
Sbjct  1    QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQN 37
 Score = 44.3 bits 164,  Expect = 5e-06
 Identities = 18/33 54%, Positives = 24/33 72%, Gaps = 0/33 0%
Query  25   AEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCG 57
            +++CG QAGG  CP   CCSQ+G CG  ++YCG
Sbjct  43   SKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCG 75
 Score = 40.7 bits 148,  Expect = 6e-05
 Identities = 19/38 50%, Positives = 23/38 60%, Gaps = 1/38 2%
Query  30   RQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQ-CGGV 67
            + AGG +C    CCS++G CG    YCG  CQS  C GV
Sbjct  134  KDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGV 172

Sequence Alignment: 12. Allergen Name: Tri a 18 Sequence ID: AAA34258

 Score = 53.0 bits 203,  Expect = 1e-08
 Identities = 52/160 32%, Positives = 69/160 43%, Gaps = 27/160 16%
Query  5    TASLPLLLLLLVGLLAGEAFAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQ--- 61
            T +L L   +++ + A  A A++CG Q     CP  LCCSQ+G+CG   DYCG  CQ   
Sbjct  7    TMALTLGAAVFLAFAAATAQAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGA 66
Query  62   --------SQCGGVTPSPGGGVASLISQSVFN--------QMLKHRNDAAC--QAKGFYT 103
                    SQ GG T  P     S   +  F         Q    R D  C  Q+ G   
Sbjct  67   CWTSKRCGSQAGGAT-CPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLC 125
Query  104  YNAFIAAANSFNGFASVGDTATRKREIAAFLAQTSHETTGGWATAPDGPYAWGYCFLKEQ 163
             N +  +   F G+ S       +    +       +  G   T       WG C     
Sbjct  126  PNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSC----- 180
Query  164  GNPPDYC 170
            G  P YC
Sbjct  181  GIGPGYC 187

Sequence Alignment: 13. Allergen Name: Bra r 2 Sequence ID: P81729

 Score = 47.4 bits 176,  Expect = 3e-07
 Identities = 21/40 52%, Positives = 28/40 70%, Gaps = 2/40 5%
Query  31   QAGGALCPGGLCCSQFGWCGSTSDYCGP--TCQSQCGGVTPS 70
            QAGG  C G +CCSQ+G+CG+T+DYC P   CQ+      P+
Sbjct  1    QAGGQTCAGNICCSQYGYCGTTADYCSPDNNCQATYHYYNPA 42

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.