The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN
QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV
VVTVKLLGDNGVLACAIATHAKIRD
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9TZZ2 Eur m 2 145 971 297.6 9e-83
AAC82350 Eur m 2.0102 135 906 278.1 6.3e-77
CAK22338 Der p 2.0114 146 875 268.7 4.6e-74
P49278 Der p 2 146 872 267.8 8.6e-74
Q00855 Der f 2 146 840 258.1 6.9e-71
BAA01241 Der f 2 138 804 247.3 1.2e-67
BAA01239 Der f 2 138 800 246.1 2.7e-67
ABA39437 Der p 2.0109 129 795 244.7 6.8e-67
CAQ68249 Der p 2.0115 129 793 244.1 1e-66
ABA39438 Der f 2.0109 129 742 228.7 4.4e-62
AAK30133 Der f 2 170 707 217.9 1e-58
A6XEN8 Blo t 2.0104 142 420 131.6 7.9e-33
A6XEN9 Blo t 2.0104 142 420 131.6 7.9e-33
A6XEP1 Blo t 2.0104 142 410 128.6 6.4e-32
A6XEP2 Blo t 2.0104 142 410 128.6 6.4e-32
A6XEP6 Blo t 2.0104 142 410 128.6 6.4e-32
A6XEP3 Blo t 2.0104 142 409 128.3 7.9e-32
BAX34757 Der f 35.0101 143 406 127.4 1.5e-31
A6XEP5 Blo t 2.0104 142 404 126.8 2.2e-31
A6XEP4 Blo t 2.0104 142 402 126.2 3.4e-31
A6XEP0 Blo t 2.0104 142 400 125.6 5.2e-31
AAQ73482 Blo t 2.0102 142 396 124.4 1.2e-30
P80384 Lep d 2 141 389 122.3 5.1e-30
CAD32314 Lep d 2.0202 141 389 122.3 5.1e-30
AAQ73483 Blo t 2.0101 144 388 122.0 6.5e-30
CAA58755 Lep d 2.0201 141 384 120.8 1.4e-29
CAD32313 Lep d 2.0102 141 384 120.8 1.4e-29
O02380 Tyr p 2 141 377 118.7 6.2e-29
AAQ73481 Blo t 2.0103 141 358 113.0 3.3e-27
CAB76459 Gly d 2.0201 125 356 112.5 4.1e-27
CAB59976 Gly d 2.0101 128 330 104.6 9.7e-25
CAA57160 Lep d 2.0101 98 281 90.1 1.8e-20
ABG76195 Der f 22.0101 155 279 89.1 5.5e-20
Q28895 Can f 7.0101 149 174 57.5 1.7e-10
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 297.6 bits 971,  Expect = 9e-83
 Identities = 145/145 100%, Positives = 145/145 100%, Gaps = 0/145 0%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN
Sbjct  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV
Sbjct  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
Query  121  VVTVKLLGDNGVLACAIATHAKIRD 145
            VVTVKLLGDNGVLACAIATHAKIRD
Sbjct  121  VVTVKLLGDNGVLACAIATHAKIRD 145

Sequence Alignment: 2. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 278.1 bits 906,  Expect = 6e-77
 Identities = 134/135 99%, Positives = 135/135 100%, Gaps = 0/135 0%
Query  11   VAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 70
            VAAVAADQVD+KDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI
Sbjct  1    VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEI 60
Query  71   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 130
            KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN
Sbjct  61   KATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 120
Query  131  GVLACAIATHAKIRD 145
            GVLACAIATHAKIRD
Sbjct  121  GVLACAIATHAKIRD 135

Sequence Alignment: 3. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 268.7 bits 875,  Expect = 5e-74
 Identities = 124/145 85%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            MYKILCLSLLVAAVAADQVD+KDCANHEIKKV+VPGC GSEPC+IHRG  FQLEA+F+AN
Sbjct  2    MYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEAN 61
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            QN+  AKIEIKA+IDG+E+DVPGID N CH++KCPLVKGQ+YDIKYTWNVP+IAPKSENV
Sbjct  62   QNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
Query  121  VVTVKLLGDNGVLACAIATHAKIRD 145
            VVTVK+LGDNGVLACAIATHAKIRD
Sbjct  122  VVTVKVLGDNGVLACAIATHAKIRD 146

Sequence Alignment: 4. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 267.8 bits 872,  Expect = 9e-74
 Identities = 123/145 84%, Positives = 137/145 94%, Gaps = 0/145 0%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            MYKILCLSLLVAAVA DQVD+KDCANHEIKKV+VPGC GSEPC+IHRG  FQLEAVF+AN
Sbjct  2    MYKILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEAN 61
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            QN+  AKIEIKA+IDG+E+DVPGID N CH+MKCPLVKGQ+YDIKYTWNVP+IAPKSENV
Sbjct  62   QNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENV 121
Query  121  VVTVKLLGDNGVLACAIATHAKIRD 145
            VVTVK++GD+GVLACAIATHAKIRD
Sbjct  122  VVTVKVMGDDGVLACAIATHAKIRD 146

Sequence Alignment: 5. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 258.1 bits 840,  Expect = 7e-71
 Identities = 120/143 83%, Positives = 132/143 92%, Gaps = 0/143 0%
Query  3    KILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQN 62
            KILCLSLLVAAV ADQVD+KDCAN+EIKKVMV GC GS+PC+IHRG  F LEA+FDANQN
Sbjct  4    KILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQN 63
Query  63   SNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVV 122
            +  AKIEIKA++DG+EIDVPGID N CHFMKCPLVKGQ+YDIKYTWNVP+IAPKSENVVV
Sbjct  64   TKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVV 123
Query  123  TVKLLGDNGVLACAIATHAKIRD 145
            TVKL+GDNGVLACAIATH KIRD
Sbjct  124  TVKLIGDNGVLACAIATHGKIRD 146

Sequence Alignment: 6. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 247.3 bits 804,  Expect = 1e-67
 Identities = 115/138 83%, Positives = 127/138 92%, Gaps = 0/138 0%
Query  8    SLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAK 67
            SLLVAAV ADQVD+KDCAN+EIKKVMV GC GS+PC+IHRG  F LEA+FDANQN+  AK
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  68   IEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLL 127
            IEIKA++DG+EIDVPGID N CHFMKCPLVKGQ+YD KYTWNVP+IAPKSENVVVTVKL+
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLV 120
Query  128  GDNGVLACAIATHAKIRD 145
            GDNGVLACAIATHAKIRD
Sbjct  121  GDNGVLACAIATHAKIRD 138

Sequence Alignment: 7. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 246.1 bits 800,  Expect = 3e-67
 Identities = 114/138 82%, Positives = 127/138 92%, Gaps = 0/138 0%
Query  8    SLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAK 67
            SLLVAAV ADQVD+KDCAN+EIKKVMV GC GS+PC+IHRG  F LEA+FDANQN+  AK
Sbjct  1    SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAK 60
Query  68   IEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLL 127
            IEIKA++DG+EIDVPGID N CHF+KCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVKL+
Sbjct  61   IEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI 120
Query  128  GDNGVLACAIATHAKIRD 145
            GDNGVLACAIATH KIRD
Sbjct  121  GDNGVLACAIATHGKIRD 138

Sequence Alignment: 8. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 244.7 bits 795,  Expect = 7e-67
 Identities = 111/129 86%, Positives = 122/129 94%, Gaps = 0/129 0%
Query  17   DQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG 76
            DQVD+KDCANHEIKKV+VPGC GSEPC+IHRG  FQLEAVF+ANQNS  AKIEIKA+IDG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  77   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACA 136
            +E+DVPGID N CH+MKCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVK+LGDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACA 120
Query  137  IATHAKIRD 145
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 9. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 244.1 bits 793,  Expect = 1e-66
 Identities = 110/129 85%, Positives = 122/129 94%, Gaps = 0/129 0%
Query  17   DQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG 76
            DQVD+KDCANHEIKKV+VPGC GSEPC+IHRG  FQLEAVF+ANQNS  AKIEIKA+IDG
Sbjct  1    DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDG 60
Query  77   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACA 136
            +E+DVPGID N CH+MKCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVK++GDNGVLACA
Sbjct  61   LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLACA 120
Query  137  IATHAKIRD 145
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 10. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 228.7 bits 742,  Expect = 4e-62
 Identities = 105/129 81%, Positives = 118/129 91%, Gaps = 0/129 0%
Query  17   DQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG 76
            DQVD+KDCAN+EIKKVMV G  GS+PC+IHRG  F LEA+FDANQN+  AKIEIKA I+G
Sbjct  1    DQVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANING 60
Query  77   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACA 136
            +E+DVPGID N CHF+KCPLVKGQ+YDIKYTWNVP+IAPKSENVVVTVKL+GDNGVLACA
Sbjct  61   LEVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACA 120
Query  137  IATHAKIRD 145
            IATHAKIRD
Sbjct  121  IATHAKIRD 129

Sequence Alignment: 11. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 217.9 bits 707,  Expect = 1e-58
 Identities = 118/141 83%, Positives = 130/141 92%, Gaps = 29/141 20%
Query  5    LCLSLLVAAVAADQVDIKDC-----------------------------ANHEIKKVMVP 35
            LCLSLLVAAV ADQVD+KDC                             AN+EIKKVMV 
Sbjct  1    LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD 60
Query  36   GCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCP 95
            GC GS+PC+IHRG  F LEA+FDANQN+  AKIEIKA++DG+EIDVPGID N CHFMKCP
Sbjct  61   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 120
Query  96   LVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACAIATHAKIRD 145
            LVKGQ+YDIKYTWNVP+IAPKSENVVVTVKL+GDNGVLACAIATH KIRD
Sbjct  121  LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170

Sequence Alignment: 12. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 131.6 bits 420,  Expect = 8e-33
 Identities = 59/133 44%, Positives = 88/133 66%, Gaps = 2/133 1%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   C IH+G +F L+  F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CTIHKGKSFTLKTFFIAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I AT++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 13. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 131.6 bits 420,  Expect = 8e-33
 Identities = 58/133 43%, Positives = 88/133 66%, Gaps = 2/133 1%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   C IH+G +F L+  F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CTIHKGKSFTLKTFFIAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I AT++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P + P  + V
Sbjct  60   QDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTV 119
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 14. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 128.6 bits 410,  Expect = 6e-32
 Identities = 57/133 42%, Positives = 87/133 65%, Gaps = 2/133 1%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   C+IH+G +F L+  F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 15. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 128.6 bits 410,  Expect = 6e-32
 Identities = 57/133 42%, Positives = 87/133 65%, Gaps = 2/133 1%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   C+IH+G +F L+  F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 16. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 128.6 bits 410,  Expect = 6e-32
 Identities = 57/133 42%, Positives = 87/133 65%, Gaps = 2/133 1%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   C+IH+G +F L+  F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 17. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 128.3 bits 409,  Expect = 8e-32
 Identities = 56/133 42%, Positives = 87/133 65%, Gaps = 2/133 1%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   C+IH+G +F L+  F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + +
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTI 119
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 18. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 127.4 bits 406,  Expect = 1e-31
 Identities = 59/142 41%, Positives = 95/142 66%, Gaps = 4/142 2%
Query  1    MYKILCLSLLVAAVA-ADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDA 59
            M K LC+  L  AVA A ++   DC + E+  + V GC+G + CV+H+G    L+    +
Sbjct  1    MIKFLCIFALTFAVASAGKMKFVDCGHKEVISLDVSGCEG-DYCVLHKGKTIDLDMKCKS 59
Query  60   NQNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSEN 119
            NQ+S   K+ I A ++G+EI+VPG D + CH+++CP+ KGQ+YDIKY++NVP + P  + 
Sbjct  60   NQDSEHLKLIISADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKG 119
Query  120  VVVTVKLLGDNGVLACAIATHAKIRD 145
             + T K++GDNG++ C +  + +I D
Sbjct  120  TL-TAKVIGDNGLVGC-LKLNGEIAD 143

Sequence Alignment: 19. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 126.8 bits 404,  Expect = 2e-31
 Identities = 56/133 42%, Positives = 86/133 64%, Gaps = 2/133 1%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV+   A  V   DCA+ E+  + +  C G   C IH+G +F L+  F AN
Sbjct  1    MFKFICLALLVSYATAGDVKFTDCAHGEVTSLDLSRCSGDH-CTIHKGKSFTLKTFFIAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I AT++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P + P  + V
Sbjct  60   QDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTV 119
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 20. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 126.2 bits 402,  Expect = 3e-31
 Identities = 56/133 42%, Positives = 87/133 65%, Gaps = 2/133 1%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC   + C+IH+G +F L+  F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCS-DDHCIIHKGKSFTLKTFFIAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 21. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 125.6 bits 400,  Expect = 5e-31
 Identities = 56/133 42%, Positives = 86/133 64%, Gaps = 2/133 1%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV+  AA  V   DCA+ E+  + + GC G   C+I +G +F L+  F AN
Sbjct  1    MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIRKGKSFTLKTFFIAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 22. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 124.4 bits 396,  Expect = 1e-30
 Identities = 55/133 41%, Positives = 85/133 63%, Gaps = 2/133 1%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV+  A   V    CA+ E+  + + GC G   C+IH+G +F L+  F AN
Sbjct  1    MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  60   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 119
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  120  T-TASLVGDHGVVAC 133

Sequence Alignment: 23. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 122.3 bits 389,  Expect = 5e-30
 Identities = 57/140 40%, Positives = 87/140 62%, Gaps = 3/140 2%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + CVIHRG    LEA F AN
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q++    I++ A + G  I VPG++ + C F+KCP+ KG+  D  Y+  +P I PK +  
Sbjct  60   QDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-A 118
Query  121  VVTVKLLGDNGVLACAIATHAKI 143
             VT +L+GD+GV+AC    H ++
Sbjct  119  DVTAELIGDHGVMACG-TVHGQV 140

Sequence Alignment: 24. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 122.3 bits 389,  Expect = 5e-30
 Identities = 57/140 40%, Positives = 87/140 62%, Gaps = 3/140 2%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + CVIHRG    L+A F AN
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q++N   I++ A + G  I VPG++ + C  +KCP+ KG+  D  Y   +P I PK + V
Sbjct  60   QDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-V 118
Query  121  VVTVKLLGDNGVLACAIATHAKI 143
             VT +L+GD+GV+AC    H ++
Sbjct  119  DVTAELVGDHGVMACG-TIHGQV 140

Sequence Alignment: 25. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 122.0 bits 388,  Expect = 6e-30
 Identities = 56/133 42%, Positives = 86/133 64%, Gaps = 4/133 3%
Query  1    MYKILCLSLLV--AAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFD 58
            M+K +CL+LL   +  AA  V   DCA+ E+  + + GC G   C+IH+G +F L+  F 
Sbjct  1    MFKFICLALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFI 59
Query  59   ANQNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSE 118
            ANQ+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  +
Sbjct  60   ANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLK 119
Query  119  NVVVTVKLLGDNGVLAC 135
             V  T  L+GD+GV+AC
Sbjct  120  TVT-TASLVGDHGVVAC 135

Sequence Alignment: 26. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 120.8 bits 384,  Expect = 1e-29
 Identities = 56/140 40%, Positives = 86/140 61%, Gaps = 3/140 2%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + CVIHRG    L+A F AN
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q++N   I++ A + G  I VPG++ + C  +KCP+ KG+  D  Y   +P I PK +  
Sbjct  60   QDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-A 118
Query  121  VVTVKLLGDNGVLACAIATHAKI 143
             VT +L+GD+GV+AC    H ++
Sbjct  119  DVTAELVGDHGVMACG-TIHGQV 140

Sequence Alignment: 27. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 120.8 bits 384,  Expect = 1e-29
 Identities = 56/140 40%, Positives = 86/140 61%, Gaps = 3/140 2%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M K + L  LVA  +A ++  KDC + E+ ++ + GC G + CVIHRG    LEA F AN
Sbjct  1    MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAAN 59
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q++    I++   + G  I VPG++ + C F+KCP+ KG+  D  Y+  +P I PK +  
Sbjct  60   QDTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-A 118
Query  121  VVTVKLLGDNGVLACAIATHAKI 143
             VT +L+GD+GV+AC    H ++
Sbjct  119  DVTAELIGDHGVMACG-TVHGQV 140

Sequence Alignment: 28. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 118.7 bits 377,  Expect = 6e-29
 Identities = 60/136 44%, Positives = 87/136 63%, Gaps = 7/136 5%
Query  3    KILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQN 62
            K L L  LVA  AA QV   DC   EI  V V GC+G + CVIH+    ++ A F ANQ+
Sbjct  2    KFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQD 60
Query  63   SNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVV 122
            +   ++++   ++G+E+ +PGI+ + C  +KCPL KG +Y + Y+ NVP + P   N+  
Sbjct  61   TCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKT 117
Query  123  TVKLL--GDNGVLAC-AIATHAK 142
             VKLL  G++GVLAC A+ T  K
Sbjct  118  VVKLLATGEHGVLACGAVNTDVK 140

Sequence Alignment: 29. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 113.0 bits 358,  Expect = 3e-27
 Identities = 52/132 39%, Positives = 83/132 62%, Gaps = 3/132 2%
Query  1    MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDAN 60
            M+K +CL+LLV++        + C   E+  + + GC G   C+IH+G +F L+  F AN
Sbjct  1    MFKFICLALLVSSRRQRCQIYRSCT-WEVTSLDLSGCSGDH-CIIHKGKSFTLKTFFIAN 58
Query  61   QNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENV 120
            Q+S   +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P  + V
Sbjct  59   QDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTV 118
Query  121  VVTVKLLGDNGVLAC 135
              T  L+GD+GV+AC
Sbjct  119  T-TASLVGDHGVVAC 132

Sequence Alignment: 30. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 112.5 bits 356,  Expect = 4e-27
 Identities = 53/116 45%, Positives = 75/116 64%, Gaps = 2/116 1%
Query  18   QVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDGV 77
            ++  KDC   E+ ++ +  C G + CVIHRG  + LEA F ANQ++  A I++ A + G 
Sbjct  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  78   EIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLAC 135
             I VPG++ + C F+KCP+ KG   D KYT  VP I PK +   VT +L+GD+GVLAC
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117

Sequence Alignment: 31. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 104.6 bits 330,  Expect = 1e-24
 Identities = 48/116 41%, Positives = 79/116 68%, Gaps = 4/116 3%
Query  18   QVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG- 76
            +++  DC ++EIK++ V  C G+  CVIHRG  + L+A FDANQ++ +  + + A IDG 
Sbjct  2    KMNFTDCGHNEIKELSVSNCTGNY-CVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  77   VEIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWN-VPRIAPKSENVVVTVKLLGDNGVLAC 135
            + ID+PG++ N C +MKCP+ KG+  ++ Y    +P   P+ +   V  +L+G++GVLAC
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119

Sequence Alignment: 32. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 90.1 bits 281,  Expect = 2e-20
 Identities = 41/97 42%, Positives = 61/97 62%, Gaps = 2/97 2%
Query  45   IHRGTAFQLEAVFDANQNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDI 104
            IHRG    LEA F ANQ++    I++ A + G  I VPG++ + C F+KCP+ KG+  D 
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  105  KYTWNVPRIAPKSENVVVTVKLLGDNGVLACAIATHAKI 143
             Y+  +P I PK +   VT +L+GD+GV+AC    H ++
Sbjct  61   IYSGTIPAITPKVK-ADVTAELIGDHGVMACG-TVHGQV 97

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 89.1 bits 279,  Expect = 6e-20
 Identities = 54/133 40%, Positives = 79/133 59%, Gaps = 11/133 8%
Query  2    YKILCLSL--LVAAVAADQVDI--KDCANHEIKKVMVPGCKGSEP-CVIHRGTAFQLEAV 56
            + I+C++L  L AAV AD+ ++  KDC ++EIK   V G   ++  CVIH+ +  QL   
Sbjct  4    FLIVCMALFCLAAAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRIS 63
Query  57   FDANQNS-NAAKIEIKATIDGVEIDVPGIDN-NLC--HFMKCPLVKGQEYDIKYTWNVPR 112
            F AN+N+ N         + G+E+  PGID  + C  H + CPL KGQ Y+    +N+  
Sbjct  64   FVANENTGNKINTRFICNLGGIELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGD 123
Query  113  IAPKSENVVVTVKLL-GDNGVLAC 135
              P + NV  TV+L  G  G L C
Sbjct  124  DVP-TANVTATVRLENGHGGDLLC 146

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 57.5 bits 174,  Expect = 2e-10
 Identities = 35/110 31%, Positives = 56/110 50%, Gaps = 5/110 4%
Query  19   VDIKDC--ANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDG 76
            V  KDC  A   IK++ V  C  ++PC +H+G ++ +   F +N  S ++K  +   + G
Sbjct  22   VHFKDCGSAVGVIKELNVNPCP-AQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLG 80
Query  77   VEIDVPGIDNNLCHF-MKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDN 130
            V +  P  + + C   + CP+ K + Y       V    P S  +VV   LLGDN
Sbjct  81   VAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYP-SIKLVVQWMLLGDN 134

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.