The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG
LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG
SSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEK
NMQIHYLICNYGPAGNYLGQPIYTKK
Sequence Info Allergen Name Length Opt Bits Score E Value
P81656 Pol d 5 206 1428 340.4 2.4e-95
P83377 Pol g 5 206 1408 335.7 6e-94
Q05109 Pol a 5 209 1240 296.6 3.6e-82
P35780 Pol f 5 205 1237 295.9 5.7e-82
P35759 Pol e 5.0101 205 1229 294.1 2.1e-81
AAT95009 Pol e 5.0101 226 1213 290.3 3e-80
C0HJV9 Poly p 5.0101 206 1138 272.9 5e-75
Q7Z156 Poly s 5.0101 207 1135 272.2 8.1e-75
P86686 Poly p 5.0102 207 1113 267.1 2.8e-73
P10737 Dol m 5.02 215 1001 241.0 2.1e-65
AAA28302 Dol m 5.02 212 993 239.1 7.4e-65
Q05108 Dol a 5 203 956 230.5 2.8e-62
P10736 Dol m 5.0101 227 937 226.1 6.6e-61
P35781 Vesp c 5 202 900 217.5 2.3e-58
P35785 Ves p 5 204 892 215.6 8.4e-58
P35787 Ves vi 5 206 891 215.4 1e-57
P35786 Ves s 5 205 888 214.7 1.6e-57
Q05110 Ves v 5 227 887 214.5 2.1e-57
P0DMB9 Vesp v 5.0101 202 886 214.2 2.2e-57
P35760 Ves m 5 204 886 214.2 2.2e-57
P35782 Vesp c 5 202 885 214.0 2.6e-57
P81657 Vesp m 5 202 883 213.5 3.6e-57
P35783 Ves f 5 204 882 213.3 4.2e-57
P35784 Ves g 5 204 870 210.5 2.9e-56
C0ITL3 Pac c 3.0101 199 676 165.4 1.1e-42
P35779 Sol r 3 211 650 159.3 7.9e-41
P35778 Sol i 3 234 647 158.6 1.4e-40
QEA69430 Sco m 5.0101 210 385 97.6 2.9e-22
AAF65314 Cte f 2 264 329 84.6 3.1e-18
ABC58726 Sol s 3.0101 90 252 66.7 2.5e-13
AAF82096 Glo m 5 259 256 67.6 3.9e-13
7065471 Pol m 5.0101 37 240 63.9 7.2e-13
AVD29822 Art an 2.0101 163 226 60.6 3.1e-11
AVD29825 Art gm 2.0101 163 226 60.6 3.1e-11
A0A2L1DGQ3 Art ar 2.0101 163 225 60.4 3.6e-11
AVD29826 Art la 2.0101 163 225 60.4 3.6e-11
AVD29827 Art si 2.0101 163 225 60.4 3.6e-11
AAY32926 Sol g 3.0101 70 219 59.0 4.1e-11
AVD29824 Art ca 2.0101 163 222 59.7 5.9e-11
AAU15051 Cyn d 24.0101 153 202 55.0 1.4e-09
ADM18345 Tab y 5.0101 256 203 55.3 2e-09
XP_007199020 Pru p 9.0101 161 136 39.7 6.1e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 340.4 bits 1428,  Expect = 2e-95
 Identities = 206/206 100%, Positives = 206/206 100%, Gaps = 0/206 0%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG
Sbjct  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG
Sbjct  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
Query  121  SSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEK 180
            SSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEK
Sbjct  121  SSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEK 180
Query  181  NMQIHYLICNYGPAGNYLGQPIYTKK 206
            NMQIHYLICNYGPAGNYLGQPIYTKK
Sbjct  181  NMQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 2. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 335.7 bits 1408,  Expect = 6e-94
 Identities = 202/206 98%, Positives = 205/206 99%, Gaps = 0/206 0%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            NDYCKIKCSSGVHTVCQYGESTKPSKNCAGK+IKSVGPTEEEKKLIVEEHNRFRQKVA+G
Sbjct  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVAQG 60
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQPAASNMNNLVWNDE AKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG
Sbjct  61   LETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
Query  121  SSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEK 180
            SSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEK
Sbjct  121  SSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEK 180
Query  181  NMQIHYLICNYGPAGNYLGQPIYTKK 206
            NM+IHYLICNYGPAGNYLGQPIYTKK
Sbjct  181  NMKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 3. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 296.6 bits 1240,  Expect = 4e-82
 Identities = 176/204 86%, Positives = 187/204 91%, Gaps = 1/204 0%
Query  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGL 61
            DYCKIKC SG+HTVCQYGESTKPSKNCAGK+IKSVGPTEEEKKLIV EHNRFRQKVA+GL
Sbjct  6    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 65
Query  62   ETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
            ETRGNPGPQPAAS+MN+LVWNDELA IAQVWASQCQ LVHDKCRNT KY VGQNIAYAG 
Sbjct  66   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 125
Query  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
            SN +P V  LI+LWENEVKDFNYNTGIT +NF K+GHYTQMVWG TKE+GCGSLKY+E N
Sbjct  126  SN-LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENN 184
Query  182  MQIHYLICNYGPAGNYLGQPIYTKK 206
            MQ HYLICNYGPAGNYLGQ  YTKK
Sbjct  185  MQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 4. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 295.9 bits 1237,  Expect = 6e-82
 Identities = 176/204 86%, Positives = 187/204 91%, Gaps = 1/204 0%
Query  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGL 61
            DYCKIKCSSG+HTVCQYGESTKPSKNCA K+IKSVGPTEEEKKLIV EHNRFRQKVA+GL
Sbjct  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
Query  62   ETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
            ETRGNPGPQPAAS+MNNLVWNDELA IAQVWASQCQILVHDKCRNT KYQVGQNIAYAG 
Sbjct  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGG 121
Query  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
            S  +P V  LI+LWENEVKDFNYN GIT +NFGKVGHYTQM+W  TKE+GCGSLKY++ N
Sbjct  122  SK-LPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
Query  182  MQIHYLICNYGPAGNYLGQPIYTKK 206
            MQ HYLICNYGPAGNYLGQ  YTKK
Sbjct  181  MQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 5. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 294.1 bits 1229,  Expect = 2e-81
 Identities = 174/204 85%, Positives = 185/204 90%, Gaps = 1/204 0%
Query  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGL 61
            DYCKIKC SG+HTVCQYGESTKPSKNCAGK+IKSVGPTEEEKKLIV EHNRFRQKVA+GL
Sbjct  2    DYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 61
Query  62   ETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
            ETRGNPGPQPAAS+MN+LVWNDELA IAQVWASQCQ LVHDKCRNT KY VGQNIAYAG 
Sbjct  62   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 121
Query  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
            S  +P V  LI+LWENEVKDFNYNTGIT +NF K+GHYTQMVWG TKE+GCGSLKY+E  
Sbjct  122  SK-LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
Query  182  MQIHYLICNYGPAGNYLGQPIYTKK 206
            MQ HYLICNYGPAGNYLGQ  YTKK
Sbjct  181  MQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 6. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 290.3 bits 1213,  Expect = 3e-80
 Identities = 172/204 84%, Positives = 184/204 90%, Gaps = 1/204 0%
Query  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGL 61
            DYCKI+C SG+HTVCQYGESTKPSKNCAGK+IKSVGPTEEEKKLIV EHNRFRQKVA+GL
Sbjct  23   DYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGL 82
Query  62   ETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
            ETRGNPGPQPAAS+MN+LVWNDELA IAQVWASQCQ LVHDKCRNT KY VGQNIAYAG 
Sbjct  83   ETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAGG 142
Query  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
            S  +P V  LI+LWENEVKDFNYNTGIT +NF K+GHYTQMVWG TKE+GCGSLKY+E  
Sbjct  143  SK-LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENK 201
Query  182  MQIHYLICNYGPAGNYLGQPIYTKK 206
            MQ HYLICNYGPAGNYLGQ   TKK
Sbjct  202  MQNHYLICNYGPAGNYLGQLPNTKK 226

Sequence Alignment: 7. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 272.9 bits 1138,  Expect = 5e-75
 Identities = 159/206 77%, Positives = 176/206 85%, Gaps = 0/206 0%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            N YC IKCS   HTVCQYGESTKPS  C    I SVG TEEEKKLIV+EHNRFRQKVA+G
Sbjct  1    NKYCNIKCSKVAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQG 60
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQPAAS+MNNLVWNDELA IAQVWASQCQ +VHDKCRNT +YQVGQNIAY+ 
Sbjct  61   LETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSA 120
Query  121  SSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEK 180
            S+  +P +  LI LWENEVKDFNY+ GIT +NF KVGHYTQ+VW  TKEVGCGS+KY+EK
Sbjct  121  STAAYPGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAKTKEVGCGSIKYIEK 180
Query  181  NMQIHYLICNYGPAGNYLGQPIYTKK 206
             M+ HYL+CNYGPAGNY+GQPIYTKK
Sbjct  181  GMKSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 8. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 272.2 bits 1135,  Expect = 8e-75
 Identities = 160/206 77%, Positives = 178/206 86%, Gaps = 1/206 0%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPS-KNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAK 59
            N YC IKCS   HTVCQYGESTKPS KNC    I SVG TEEEKKLIV+EHNRFRQKVA+
Sbjct  1    NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQ 60
Query  60   GLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYA 119
            GLETRGNPGPQPAAS+MNNLVWNDELA IAQVWA+QCQ +VHDKCRNT +YQVGQNIAY+
Sbjct  61   GLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYS 120
Query  120  GSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
             S+  +P +  LI LWENEVKDFNY+ GIT +NF KVGHYTQ+VW  TKEVGCGS+KY+E
Sbjct  121  ASTAAYPGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIE 180
Query  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206
            K M+ HYL+CNYGPAGNY+GQPIYTKK
Sbjct  181  KGMKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 9. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 267.1 bits 1113,  Expect = 3e-73
 Identities = 161/206 78%, Positives = 175/206 84%, Gaps = 1/206 0%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPS-KNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAK 59
            N YC IKCS   HTVCQ GESTKPS KNCA   I SVG TEEEKKLIV+EHNRFRQKVA+
Sbjct  1    NKYCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQ 60
Query  60   GLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYA 119
            GLETRGNPGPQPAAS+MNNLVWNDELA IAQVWASQCQ +VHDKCRNT +YQVGQNIAY+
Sbjct  61   GLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYS 120
Query  120  GSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
             S+  +P V KLI LWENEVKDFNYNTGIT +NF KVGHYTQ+VW  TKEVGCGS+KY+E
Sbjct  121  ASTAAYPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIE 180
Query  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206
            K M+ HYL+CNYGPAGN LG  IY  K
Sbjct  181  KGMKSHYLVCNYGPAGNVLGAQIYEIK 207

Sequence Alignment: 10. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 241.0 bits 1001,  Expect = 2e-65
 Identities = 138/203 67%, Positives = 168/203 82%, Gaps = 5/203 2%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            N+YCKIKCS G+HT+C++G S KP  NC  KL+K  G + +EK  IV  HN+FRQKVAKG
Sbjct  11   NNYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKG 68
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQP A NMN LVWNDELAKIAQ WA+QC  + HD+CRNTEKYQVGQN+A A 
Sbjct  69   LETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCS-FGHDQCRNTEKYQVGQNVAIAS 127
Query  121  SS-NHFPSVTKLIQLWENEVKDFNYNTG-ITNKNFGKVGHYTQMVWGNTKEVGCGSLKYV 178
            ++ N + +++KLI++WENEVKDFN   G + + NF KVGHYTQMVWG TKE+GCGS+KY+
Sbjct  128  TTGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYI 187
Query  179  EKNMQIHYLICNYGPAGNYLGQPIYTKK 206
            E N + HYL+CNYGPAGNY+ QPIY +K
Sbjct  188  ENNWHTHYLVCNYGPAGNYMDQPIYERK 215

Sequence Alignment: 11. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 239.1 bits 993,  Expect = 7e-65
 Identities = 137/200 68%, Positives = 166/200 83%, Gaps = 5/200 2%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            N+YCKIKCS G+HT+C++G S KP  NC  KL+K  G + +EK  IV  HN+FRQKVAKG
Sbjct  11   NNYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKG 68
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQP A NMN LVWNDELAKIAQ WA+QC  + HD+CRNTEKYQVGQN+A A 
Sbjct  69   LETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCS-FGHDQCRNTEKYQVGQNVAIAS 127
Query  121  SS-NHFPSVTKLIQLWENEVKDFNYNTG-ITNKNFGKVGHYTQMVWGNTKEVGCGSLKYV 178
            ++ N + +++KLI++WENEVKDFN   G + + NF KVGHYTQMVWG TKE+GCGS+KY+
Sbjct  128  TTGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYI 187
Query  179  EKNMQIHYLICNYGPAGNYLGQPIY 203
            E N + HYL+CNYGPAGNY+ QPIY
Sbjct  188  ENNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 12. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 230.5 bits 956,  Expect = 3e-62
 Identities = 130/202 64%, Positives = 163/202 80%, Gaps = 5/202 2%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            N+YCKI C  G HT+C+YG S KP  NC GK++KS G T +EK  IV+ HN FRQKVA+G
Sbjct  1    NNYCKI-CPKGTHTLCKYGTSMKP--NCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQG 57
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQP A NMN LVWNDELAKIAQ WA+QC  + HD+CRNT KY VGQN+A A 
Sbjct  58   LETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCN-FGHDQCRNTAKYPVGQNVAIAS 116
Query  121  SS-NHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
            ++ N + +++ LI++WE+EVKD+N +  + + NF KVGHYTQMVWG TKE+GCGS+KY+E
Sbjct  117  TTGNSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSKVGHYTQMVWGKTKEIGCGSVKYIE 176
Query  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206
               + HYL+CNYGPAGNY+ QP+Y +K
Sbjct  177  NKWHTHYLVCNYGPAGNYMNQPVYERK 203

Sequence Alignment: 13. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 226.1 bits 937,  Expect = 7e-61
 Identities = 129/203 63%, Positives = 157/203 77%, Gaps = 4/203 1%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            N+YCKIKC  G+HT+C++G S KP  NC   ++K+ G T +EK  I++ HN FRQ VAKG
Sbjct  24   NNYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKG 81
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRG PGPQP A NMN LVWNDELAKIAQ WA+QC  + HD CRNT KYQVGQNIA + 
Sbjct  82   LETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCD-FNHDDCRNTAKYQVGQNIAISS 140
Query  121  SS-NHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
            ++  +F   +KLI+ WE+EV +FNY  G+ N NF KVGHYTQMVWG TKE+GCGS+KY+E
Sbjct  141  TTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIE 200
Query  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206
             N   HYL+CNYGP GN + QPIY +K
Sbjct  201  DNWYTHYLVCNYGPGGNDFNQPIYERK 227

Sequence Alignment: 14. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 217.5 bits 900,  Expect = 2e-58
 Identities = 123/201 61%, Positives = 159/201 79%, Gaps = 6/201 2%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            N+YCKIKC SG+HT+C+YG STKP  NC   ++K+ G T++E   I+++HN FRQKVA+G
Sbjct  1    NNYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQHNEFRQKVARG 58
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQP A +MN LVWNDELA+IAQVWA+QC    HD CRN+ KY VGQNIA   
Sbjct  59   LETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-HDNCRNSAKYSVGQNIAEGS 117
Query  121  SS-NHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
            ++ ++F SV+ ++++WE+EVKD+ Y  G     + KVGHYTQMVW  TKE+GCGS+KY+E
Sbjct  118  TTADNFGSVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSIKYIE 175
Query  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206
               + HYL+CNYGPAGN   +PIY +K
Sbjct  176  NGWHRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 15. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 215.6 bits 892,  Expect = 8e-58
 Identities = 122/202 60%, Positives = 157/202 77%, Gaps = 6/202 2%
Query  1    NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAK 59
            N+YCKIKC   GVHT C+YG S KP  NC  K++ S G T+EEK+ I++EHN FRQK+A+
Sbjct  1    NNYCKIKCLKGGVHTACKYG-SLKP--NCGNKIVVSYGLTKEEKQDILKEHNDFRQKIAR 57
Query  60   GLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYA 119
            GLETRGNPGPQP A NM NLVWNDELA +AQVWA+QCQ   HD CR+  KY VGQN+A  
Sbjct  58   GLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYPVGQNVALT 116
Query  120  GSS-NHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYV 178
            GS+ + + +  KL+++WE+EVKD+N     +  NF K+GHYTQMVW NTKE+GCGS+KY+
Sbjct  117  GSTADKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNKIGHYTQMVWANTKEIGCGSIKYI 176
Query  179  EKNMQIHYLICNYGPAGNYLGQPIYTKK 206
            +   + HYL+CNYGP+GN+  + +Y  K
Sbjct  177  QNEWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 16. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 215.4 bits 891,  Expect = 1e-57
 Identities = 129/202 63%, Positives = 154/202 76%, Gaps = 5/202 2%
Query  2    DYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            +YCKIKC   GVHT C+YG STKP  NC   ++K+ G TE EK+ I++ HN FRQKVAKG
Sbjct  3    NYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKG 60
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQP A NMNNLVWNDELA IAQVWASQC    HD C++TEKY VGQNIA   
Sbjct  61   LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKRS 119
Query  121  SSNH-FPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
            ++   F S  KL+++WENEVKDFN N   +  N+ K GHYTQMVW  TKE+GCGS+KYV+
Sbjct  120  TTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVK 179
Query  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206
                 HYL+CNYGP+GN+  + +Y KK
Sbjct  180  DEWYTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 17. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 214.7 bits 888,  Expect = 2e-57
 Identities = 125/202 61%, Positives = 152/202 75%, Gaps = 5/202 2%
Query  2    DYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            DYCKIKC   GVHT C+YG STKP  NC   ++KS G T+ EK+ I++ HN FR KVA+G
Sbjct  2    DYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARG 59
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQP A NMNNLVWN+ELA IAQ+WASQC+   HD C++T KY VGQNIA + 
Sbjct  60   LETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVSS 118
Query  121  SSNH-FPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
            S+   + +V  L++ WENEVKDFN         F K+GHYTQMVW  TKE+GCGS+KYV+
Sbjct  119  STAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVD 178
Query  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206
             N   HYL+CNYGPAGN+  Q +Y +K
Sbjct  179  NNWYTHYLVCNYGPAGNFGNQEVYERK 205

Sequence Alignment: 18. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 214.5 bits 887,  Expect = 2e-57
 Identities = 122/202 60%, Positives = 157/202 77%, Gaps = 6/202 2%
Query  1    NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAK 59
            N+YCKIKC   GVHT C+YG S KP  NC  K++ S G T++EK+ I++EHN FRQK+A+
Sbjct  24   NNYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIAR 80
Query  60   GLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYA 119
            GLETRGNPGPQP A NM NLVWNDELA +AQVWA+QCQ   HD CR+  KYQVGQN+A  
Sbjct  81   GLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYQVGQNVALT 139
Query  120  GSSN-HFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYV 178
            GS+   +    KL+++WE+EVKD+N     +  +F K GHYTQMVW NTKEVGCGS+KY+
Sbjct  140  GSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYI 199
Query  179  EKNMQIHYLICNYGPAGNYLGQPIYTKK 206
            ++  + HYL+CNYGP+GN++ + +Y  K
Sbjct  200  QEKWHKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 19. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 214.2 bits 886,  Expect = 2e-57
 Identities = 123/201 61%, Positives = 156/201 77%, Gaps = 6/201 2%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            N+YCKIKC SG+HT+C+YG STKP  NC   ++K+ G T+ EK  I+++HN FRQKVA+G
Sbjct  1    NNYCKIKCRSGIHTLCKYGTSTKP--NCGRSVVKASGLTKAEKLEILKQHNEFRQKVARG 58
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQP A +MN LVWNDELA+IAQVWASQC+   HD CRNT KY VGQNIA   
Sbjct  59   LETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYG-HDNCRNTAKYLVGQNIAEQS 117
Query  121  SSN-HFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
            ++   F  V+ ++++W +EVKD+ Y  G +   +  VGHYTQMVW  TKE+GCG++KY+E
Sbjct  118  TTAASFEPVSNMVKMWSDEVKDYQY--GSSKNKLNDVGHYTQMVWAKTKEIGCGNIKYIE 175
Query  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206
               + HYL+CNYGPAGN   +PIY KK
Sbjct  176  NGWHHHYLVCNYGPAGNIGNEPIYEKK 202

Sequence Alignment: 20. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 214.2 bits 886,  Expect = 2e-57
 Identities = 124/202 61%, Positives = 157/202 77%, Gaps = 6/202 2%
Query  1    NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAK 59
            N+YCKIKC   GVHT C+YG S KP  NC  K + S G T++EK+ I++EHN FRQK+A+
Sbjct  1    NNYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIAR 57
Query  60   GLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYA 119
            GLETRGNPGPQP A NM NLVW+DELA IAQVWA+QCQ   HD CR+  KYQVGQN+A  
Sbjct  58   GLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALT 116
Query  120  GSSNH-FPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYV 178
            GS+   +    KL+++WE+EVKD+N     +  NF K+GHYTQMVW NTKEVGCGS+KY+
Sbjct  117  GSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYI 176
Query  179  EKNMQIHYLICNYGPAGNYLGQPIYTKK 206
            ++N + HYL+CNYGP+GN+  + +Y  K
Sbjct  177  QENWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 21. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 214.0 bits 885,  Expect = 3e-57
 Identities = 122/201 60%, Positives = 157/201 78%, Gaps = 6/201 2%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            N+YCKIKC SG+HT+C+YG STKP  NC   ++K+ G T++E   I+++HN FRQKVA+G
Sbjct  1    NNYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQHNEFRQKVARG 58
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRGNPGPQP A +MN LVWNDELA+IAQVWA+QC    HD CRN+ KY VGQNIA   
Sbjct  59   LETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-HDNCRNSAKYSVGQNIAEGS 117
Query  121  SS-NHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
            +S ++F +V+ ++++WE+EVKD+ Y  G     + KVGHYTQMVW  TKE+GCGS  Y+E
Sbjct  118  TSADNFVNVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSEDYIE 175
Query  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206
               + HYL+CNYGPAGN   +PIY +K
Sbjct  176  DGWHRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 22. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 213.5 bits 883,  Expect = 4e-57
 Identities = 124/201 61%, Positives = 156/201 77%, Gaps = 6/201 2%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            N+YCKIKC SG+HT+C++G STKP  NC   ++K+ G T+ EK  I+++HN FRQKVA+G
Sbjct  1    NNYCKIKCRSGIHTLCKFGISTKP--NCGKNVVKASGLTKAEKLEILKQHNEFRQKVARG 58
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
            LETRG PGPQP A +MN LVWNDELA+IAQVWA QC    HD CRNT KY VGQNIA  G
Sbjct  59   LETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYG-HDVCRNTAKYSVGQNIAENG 117
Query  121  SSN-HFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
            S+   F SV+ ++Q+W +EVK++ Y  G T   + +VGHYTQMVW  TKE+GCGS+KY+E
Sbjct  118  STAASFASVSNMVQMWADEVKNYQY--GSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIE 175
Query  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206
               + HYL+CNYGPAGN   +PIY +K
Sbjct  176  NGWHRHYLVCNYGPAGNIGNEPIYERK 202

Sequence Alignment: 23. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 213.3 bits 882,  Expect = 4e-57
 Identities = 122/202 60%, Positives = 156/202 77%, Gaps = 6/202 2%
Query  1    NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAK 59
            N+YCKIKC   GVHT C+YG S KP  NC  K++ S G T++EK+ I++EHN FRQK+A+
Sbjct  1    NNYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIAR 57
Query  60   GLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYA 119
            GLETRGNPGPQP A NM NLVWNDELA +AQVWA+QCQ   HD CR+  KYQVGQN+A  
Sbjct  58   GLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDIAKYQVGQNVALT 116
Query  120  GSSN-HFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYV 178
            GS+   +    KL+++WE+EVKD+N     +  NF K GHYTQMVW NTKEVGCGS+K++
Sbjct  117  GSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLKTGHYTQMVWANTKEVGCGSIKFI 176
Query  179  EKNMQIHYLICNYGPAGNYLGQPIYTKK 206
            ++  + HYL+CNYGP+GN+  + +Y  K
Sbjct  177  QEKWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 24. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 210.5 bits 870,  Expect = 3e-56
 Identities = 122/202 60%, Positives = 156/202 77%, Gaps = 6/202 2%
Query  1    NDYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAK 59
            N+YCKIKC   GVHT C+Y ES KP  NCA K + + G T++EK+ I++EHN FRQK+A+
Sbjct  1    NNYCKIKCLKGGVHTACKY-ESLKP--NCANKKVVAYGLTKQEKQDILKEHNDFRQKIAR 57
Query  60   GLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYA 119
            GLETRGNPGPQP A NM NLVW+DELA IAQVWA+QCQ   HD CR+  KY VGQN+A  
Sbjct  58   GLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYPVGQNVALT 116
Query  120  GSSN-HFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYV 178
            GS+   + +  KL+++WE+EVKD+N     +  NF K+GHYTQMVW NTKEVGCGS+KY+
Sbjct  117  GSTAAKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYI 176
Query  179  EKNMQIHYLICNYGPAGNYLGQPIYTKK 206
            +   + HYL+CNYGP+GN+  + +Y  K
Sbjct  177  QDKWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 25. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 165.4 bits 676,  Expect = 1e-42
 Identities = 102/188 54%, Positives = 135/188 71%, Gaps = 9/188 4%
Query  12   VHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGLETRGNPGPQP 71
            VHT+CQY  S +PS NC      +   T  +K+ I++ HN  RQKV  G ETRGNPGPQP
Sbjct  6    VHTMCQY-TSPQPSPNCG--TYSNAHITAADKETILKVHNDERQKVKAGQETRGNPGPQP 62
Query  72   AASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGSSNHFP-SVTK 130
            AASNM +L W++ELA IAQ W +QC+I  HD CRN E+YQVGQNIA +GS+   P ++  
Sbjct  63   AASNMPDLTWDNELAAIAQRWVNQCKIG-HDGCRNVERYQVGQNIAMSGSTAKGPCNMNN 121
Query  131  LIQLWENEVKDFN---YNTGITNKN-FGKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHY 186
            L+Q+W NEV  +N    ++  ++ N F K+GHYTQ+VWG T +VGCG +++++      Y
Sbjct  122  LVQMWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCY 181
Query  187  LICNYGPAGNYLGQPIY 203
            L CNYGPAGN +G PIY
Sbjct  182  LACNYGPAGNMFGAPIY 198

Sequence Alignment: 26. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 159.3 bits 650,  Expect = 8e-41
 Identities = 104/200 52%, Positives = 134/200 67%, Gaps = 14/200 7%
Query  2    DYCKIK-C--SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVA 58
            +YC ++ C  ++ +HT+CQY  S  P   C      +VG T+ EK  IV +HN +RQ+VA
Sbjct  2    NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 58
Query  59   KGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAY 118
             G E RG  GPQP A  M NL W+ ELA IAQ WA+QC  + HD CRN E++ VGQNIA 
Sbjct  59   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCT-FEHDACRNVERFAVGQNIAA 117
Query  119  AGSSNHFPS-VTKLIQLWENEVKDFNYNTGITN-----KNFGKVGHYTQMVWGNTKEVGC 172
              SS    S ++ +I LW NEVKDF+ N  I++       +  VGHYTQ+VW  TK++GC
Sbjct  118  TSSSGKNKSTLSDMILLWYNEVKDFD-NRWISSFPSDGNILMHVGHYTQIVWAKTKKIGC 176
Query  173  GSLKYVEKNMQIHYLICNYGPAGNYLGQPIYTKK 206
            G + + E N   HYL+CNYGPAGN LG  IY  K
Sbjct  177  GRIMFKEDNWNKHYLVCNYGPAGNVLGAQIYEIK 210

Sequence Alignment: 27. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 158.6 bits 647,  Expect = 1e-40
 Identities = 105/200 52%, Positives = 134/200 67%, Gaps = 15/200 7%
Query  2    DYCKIK-C--SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVA 58
            +YC ++ C  ++ +HT+CQY  S  P   C      +VG T+ EK  IV +HN +RQ+VA
Sbjct  24   NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 80
Query  59   KGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAY 118
             G E RG  GPQP A  M NL W+ ELA IAQ WA+QC  + HD CRN E++ VGQNIA 
Sbjct  81   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCT-FEHDACRNVERFAVGQNIAA 139
Query  119  AGSSNHFPSV-TKLIQLWENEVKDFNYNTGIT-----NKNFGKVGHYTQMVWGNTKEVGC 172
              SS    S   ++I LW NEVKDF+ N  I+     +  + KVGHYTQ+VW  T ++GC
Sbjct  140  TSSSGKNKSTPNEMILLWYNEVKDFD-NRWISSFPSDDNILMKVGHYTQIVWAKTTKIGC 198
Query  173  GSLKYVEK-NMQIHYLICNYGPAGNYLGQPIYTKK 206
            G + + E  N   HYL+CNYGPAGN LG PIY  K
Sbjct  199  GRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233

Sequence Alignment: 28. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 97.6 bits 385,  Expect = 3e-22
 Identities = 72/163 44%, Positives = 105/163 64%, Gaps = 18/163 11%
Query  30   GKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIA 89
            G  +K  G     KK+I++ HN+ RQ VA G ++    G QP+A+NM  L W+D++A  A
Sbjct  23   GCDMKVRGLDANMKKMILDLHNKKRQTVANGQQS----G-QPSAANMKELHWDDQIAANA 77
Query  90   QVWASQCQILVHD--KCRNTEKYQ-VGQNIAYAGSSNHFPS-VTKLIQLWENEVKDFNYN 145
            Q  A  C ++ H     R T KY  +G+NI Y GS   +P  + + +  W +EVKD    
Sbjct  78   QRSAETC-VFQHTAKNLRKTSKYSYLGENI-YMGS---YPDPIPRSVNAWYDEVKDVTPA 132
Query  146  TGITNKNFGK-VGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQPIYT 204
               + ++ G  +GHYTQMVW NT+ +GCG +   +KN    Y+ C YGP+GNY G+PIY 
Sbjct  133  VVKSFRSGGPMIGHYTQMVWANTEALGCGLVTASDKNT---YIFCQYGPSGNYPGEPIYK 189
Query  205  K 205
            +
Sbjct  190  Q 190

Sequence Alignment: 29. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 84.6 bits 329,  Expect = 3e-18
 Identities = 76/196 38%, Positives = 109/196 55%, Gaps = 24/196 12%
Query  1    NDYCKIKCSSGVHTVCQYGESTKPS--KNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVA 58
            +DYC + C++G +  C     TKP   ++C     K V  TE  KK  +  HNR R+ VA
Sbjct  32   DDYCNLNCTNGPNVGC-----TKPDVPRDCQN--FKLVNITERMKKAFLNAHNRKRRLVA 84
Query  59   KGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAY 118
             G     +    P A+ M NL WN  LAK+A+    QC+ + HD C  T   + GQN+ +
Sbjct  85   AGKGLLKDGVHTPIAAKMPNLTWNIALAKLAEYNVKQCE-MKHD-CAKTRHGHTGQNLFF 142
Query  119  AGSS---NHFPSVTKL-IQLWENEVKDF---NYNTGITNKNFGK-VGHYTQMVWGNTKEV 170
             G++       ++ K+ +  W  E KD    +     T    GK +GHYTQ++WGNT +V
Sbjct  143  YGTTLSPIKNSTIAKMAVDGWYAESKDTRLEDIKKLTTIYPNGKPIGHYTQLIWGNTTKV 202
Query  171  GCGSLKYVEK---NMQIHYLI-CNYGPAGNYLGQPIYTKK 206
            GC    Y +    NM    L+ CNY   GN L + +Y  K
Sbjct  203  GCAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIK 241

Sequence Alignment: 30. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 66.7 bits 252,  Expect = 3e-13
 Identities = 42/86 48%, Positives = 55/86 63%, Gaps = 6/86 6%
Query  2    DYCKIK-C--SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVA 58
            +YC ++ C  ++ +HT+CQY  S  P   C      +VG T+ EK  IV +HN +RQ+VA
Sbjct  2    NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCL--EYSNVGFTDAEKDAIVNKHNELRQRVA 58
Query  59   KGLETRGNPGPQPAASNMNNLVWNDELAKIAQ 90
             G E RG   PQP A  M NL W+ ELA IAQ
Sbjct  59   SGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

Sequence Alignment: 31. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 67.6 bits 256,  Expect = 4e-13
 Identities = 66/188 35%, Positives = 98/188 52%, Gaps = 24/188 12%
Query  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGL 61
            DYC + C +  H  C      +       K+I       + +  +++ HN+ R  VA G 
Sbjct  21   DYCGL-CDN--HDACVMQNVFQSGCPSGAKMID----LNKYQSALLDAHNKKRNHVAGGG 73
Query  62   ETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQ-VGQNIAYAG 120
            E++        A  M  + W+ ELAK+A+    QCQ + HD+CRNT K++  GQN+A  G
Sbjct  74   ESK-----LKRACQMATMKWDSELAKLAEYNVKQCQ-MNHDRCRNTVKFKYAGQNLAELG 127
Query  121  SSNHFPS-----VTKLIQLWENEVKDFNY---NTGITNKNFGKVGHYTQMVWGNTKEVGC 172
             S   P      + K +  W  EVKD N    ++   N     +GH+T MV      VGC
Sbjct  128  RSGGPPPDYRKLIEKAVDKWYEEVKDCNQGYIDSYPMNYRGPAIGHFTVMVAERNTHVGC 187
Query  173  GSLKYVEKN-MQIHYLICNYGPAGNYLGQPIY 203
             + +Y + N  Q   + CNY    N +  PIY
Sbjct  188  AASEYTKSNGFQYFLMACNYATT-NMMEFPIY 218

Sequence Alignment: 32. Allergen Name: Pol m 5.0101 Sequence ID: 7065471

 Score = 63.9 bits 240,  Expect = 7e-13
 Identities = 33/36 91%, Positives = 35/36 97%, Gaps = 0/36 0%
Query  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVG 37
            DYCKIKCSSG+HTVCQYGESTKPSKNCA K+IKSVG
Sbjct  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 33. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 60.6 bits 226,  Expect = 3e-11
 Identities = 60/124 48%, Positives = 80/124 64%, Gaps = 33/124 26%
Query  62   ETRGNPGPQPA----ASN-------MNNLVWNDELAKIAQVWAS----QCQILVHDKCRN 106
            ET G PG  P     A N       M  L W+DELAK+AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRC-- 82
Query  107  TEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGN 166
                  G+N+A  G+ N     +  +QLW +E  D++YN    NK     GHYTQ+VW N
Sbjct  83   ------GENMAQ-GAING----SMAVQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  167  TKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQPIY 203
            T+ VGCG  + +  N   +  +CNY P GN +GQ  Y
Sbjct  129  TERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 34. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 60.6 bits 226,  Expect = 3e-11
 Identities = 60/124 48%, Positives = 80/124 64%, Gaps = 33/124 26%
Query  62   ETRGNPGPQPA----ASN-------MNNLVWNDELAKIAQVWAS----QCQILVHDKCRN 106
            ET G PG  P     A N       M  L W+DELAK+AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRC-- 82
Query  107  TEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGN 166
                  G+N+A  G+ N     +  +QLW +E  D++YN    NK     GHYTQ+VW N
Sbjct  83   ------GENMAQ-GAING----SMAVQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  167  TKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQPIY 203
            T+ VGCG  + +  N   +  +CNY P GN +GQ  Y
Sbjct  129  TERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 35. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 60.4 bits 225,  Expect = 4e-11
 Identities = 59/124 47%, Positives = 81/124 65%, Gaps = 33/124 26%
Query  62   ETRGNPGPQPA----ASN-------MNNLVWNDELAKIAQVWAS----QCQILVHDKCRN 106
            ET G PG  P     A N       M  L W+DELAK+AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
Query  107  TEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGN 166
                  G+N+A  G+ N     +  +QLW +E  D++YN    NK     GHYTQ+VW N
Sbjct  83   ------GENMAQ-GAING----SMAVQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  167  TKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQPIY 203
            ++ VGCG  + +  N   + ++CNY P GN +GQ  Y
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 36. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 60.4 bits 225,  Expect = 4e-11
 Identities = 59/124 47%, Positives = 81/124 65%, Gaps = 33/124 26%
Query  62   ETRGNPGPQPA----ASN-------MNNLVWNDELAKIAQVWAS----QCQILVHDKCRN 106
            ET G PG  P     A N       M  L W+DELAK+AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
Query  107  TEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGN 166
                  G+N+A  G+ N     +  +QLW +E  D++YN    NK     GHYTQ+VW N
Sbjct  83   ------GENMAQ-GAING----SMAVQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  167  TKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQPIY 203
            ++ VGCG  + +  N   + ++CNY P GN +GQ  Y
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 37. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 60.4 bits 225,  Expect = 4e-11
 Identities = 59/124 47%, Positives = 82/124 66%, Gaps = 33/124 26%
Query  62   ETRGNPGPQPA----ASN-------MNNLVWNDELAKIAQVWA----SQCQILVHDKCRN 106
            ET G PG  P     A N       M  L W+DELAK+AQ WA    + C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAEARTADCSLVHSDRC-- 82
Query  107  TEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGN 166
                  G+N+A  G+ N     +  +QLW +E  D++YN    NK     GHYTQ+VW N
Sbjct  83   ------GENMAQ-GAING----SMAVQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  167  TKEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQPIY 203
            ++ VGCG  + +  N   + ++CNY P GN +GQ  Y
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 38. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 59.0 bits 219,  Expect = 4e-11
 Identities = 30/52 57%, Positives = 37/52 71%, Gaps = 1/52 1%
Query  155  KVGHYTQMVWGNTKEVGCGSLKYVEK-NMQIHYLICNYGPAGNYLGQPIYTKK 206
            K+GHYTQ+VW  T ++GCG + + E  N   HYL+CNYGPAGN LG  IY  K
Sbjct  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69

Sequence Alignment: 39. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 59.7 bits 222,  Expect = 6e-11
 Identities = 58/123 47%, Positives = 80/123 65%, Gaps = 33/123 26%
Query  63   TRGNPGPQPA----ASN-------MNNLVWNDELAKIAQVWAS----QCQILVHDKCRNT 107
            T G PG  P     A N       M  L W+DELAK+AQ WA      C ++  D+C   
Sbjct  26   TYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC--- 82
Query  108  EKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNT 167
                 G+N+A  G+ N     +  +QLW +E  D++YN    NK     GHYTQ+VW N+
Sbjct  83   -----GENMAQ-GAING----SMAVQLWLDERLDYDYNE---NKCIKMCGHYTQIVWANS 129
Query  168  KEVGCGSLKYVEKNMQIHYLICNYGPAGNYLGQPIY 203
            + VGCG  + +  N   + ++CNY P GN +GQ  Y
Sbjct  130  ERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 40. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 55.0 bits 202,  Expect = 1e-09
 Identities = 39/122 31%, Positives = 67/122 54%, Gaps = 12/122 9%
Query  72   AASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQ-VGQNIAYAGSSNHFPSVTK 130
            A  ++  L WN  LAK +Q +A     L  D C+        G+N+ +   +  + +   
Sbjct  30   AKEHVPPLTWNTTLAKFSQDYAES--KLKKD-CKMVHSDSPYGENLMFGSGAISWKTT-- 84
Query  131  LIQLWENEVKDFNYNTGITNKNFGKV-GHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLIC 189
             +  W +E K ++Y +   ++  GK+ GHYT +VW +T  VGCG  + +  + +   ++C
Sbjct  85   -VDTWSDEKKSYHYGSNTCDQ--GKMCGHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMC 139
Query  190  NYGPAGNYLGQPIY 203
            +Y P GNY  Q  Y
Sbjct  140  SYWPPGNYENQKPY 153

Sequence Alignment: 41. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 55.3 bits 203,  Expect = 2e-09
 Identities = 57/190 30%, Positives = 93/190 48%, Gaps = 20/190 10%
Query  2    DYCKI-KCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
            DYC + +   G H  C  G S   S +C G+  ++   T+E KK+I+++ N  R  VAKG
Sbjct  25   DYCSLCRGGRGEHVGC--G-SPGFSSDC-GQKARTRKFTKEHKKVILDKINDVRDHVAKG 80
Query  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
              + G     P AS M  +VW++ELA +A+     C    + KCR+T ++     + +  
Sbjct  81   --SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFEF 133
Query  121  SSNHFPSVTKLIQ--LWENEVKDFNYNTGITNKN--FGKVGHYTQMVWGNTKEV---GCG 173
             ++  PS   LI   +     +  N    I  K    G  G+  ++    +  V   GCG
Sbjct  134  YADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVGCG 193
Query  174  SLKYVEKNMQIHYLICNYGPAGNYLGQPIY 203
               +         L CN+    +Y  +P+Y
Sbjct  194  LTTWKLGGKARALLTCNFSSENDY-NRPVY 222

Sequence Alignment: 42. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 39.7 bits 136,  Expect = 6e-05
 Identities = 54/129 41%, Positives = 77/129 59%, Gaps = 31/129 24%
Query  35   SVGPTEEEKKLIVEEHNRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWAS 94
            S   ++EE    VEEHN+ R++V          G +P       L WN  LA+ AQ +A 
Sbjct  22   SANISKEEIDGFVEEHNKARKEV----------GNKP-------LKWNTTLAQYAQEYAD 64
Query  95   QCQILVHDKCRNTEKYQVGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNF- 153
            +    V D        + G+N+A +G      + TK    W  E K+F Y+   +NK   
Sbjct  65   K---RVGDCAMEHSMGRWGENLA-SGDGMSGAAATK---YWVTE-KEF-YDEK-SNKCVK 114
Query  154  GKVGHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGP 193
             + GHY  +VWG T EVGCG  K    N Q +Y++C+Y P
Sbjct  115  DECGHYLAVVWGKTTEVGCGISK--CNNGQ-NYVVCSYDP 151

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.