The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ
PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ
QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ
QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQPQQPAQLE
AIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ
Sequence Info Allergen Name Length Opt Bits Score E Value
BAN29066 Tri a 20.0101 279 2041 183.7 6.3e-48
BAA11251 Tri a gliadin 279 1830 166.2 1.2e-42
AAA34274 Tri a gliadin 291 1756 160.1 8.7e-41
AAA34288 Tri a gliadin 251 1726 157.5 4.4e-40
AAA34289 Tri a gliadin 327 1608 147.8 4.7e-37
AAA34272 Tri a gliadin 302 1234 116.7 1e-27
P80198 Hor v 21 289 848 84.7 4.3e-18
P80198 Hor v 20.0101 289 848 84.7 4.3e-18
CAA26383 Tri a gliadin 296 810 81.5 3.9e-17
AAA34290 Tri a gliadin 296 809 81.4 4.1e-17
CAA26384 Tri a gliadin 286 775 78.6 2.9e-16
CAA25261 Tri a gliadin 286 771 78.3 3.6e-16
AAA34280 Tri a gliadin 286 769 78.1 4e-16
AAA34283 Tri a gliadin 282 759 77.3 7.1e-16
AAA17741 Tri a gliadin 287 756 77.0 8.6e-16
CAA25593 Tri a gliadin 286 755 76.9 9.1e-16
CAA35238 Tri a gliadin 307 707 73.0 1.5e-14
AAA34282 Tri a gliadin 297 703 72.6 1.9e-14
AEH31546 Tri a 36.0101 369 695 72.0 3.4e-14
CAA31685 Tri a glutenin 307 680 70.7 7.1e-14
CAA30570 Tri a glutenin 356 676 70.5 1e-13
CAA59339 Tri a glutenin 261 663 69.2 1.7e-13
CAA59340 Tri a glutenin 276 657 68.8 2.5e-13
AAA34278 Tri a gliadin 319 648 68.1 4.6e-13
CAA44473 Tri a glutenin 285 638 67.2 7.6e-13
AAA34275 Tri a gliadin 318 638 67.3 8.2e-13
AAA34281 Tri a gliadin 262 633 66.8 9.5e-13
AAA34279 Tri a gliadin 313 632 66.7 1.1e-12
CAA26385 Tri a gliadin 313 630 66.6 1.3e-12
AAA34276 Tri a gliadin 291 629 66.5 1.3e-12
AAA34285 Tri a gliadin 304 615 65.3 3e-12
AAA34287 Tri a gliadin 244 581 62.4 1.8e-11
CAY54134 Tri a 21.0101 281 581 62.5 2e-11
CAA59338 Tri a glutenin 229 575 61.9 2.4e-11
AAA34286 Tri a gliadin 323 579 62.4 2.5e-11
CAA36063 Tri a glutenin 295 569 61.5 4.1e-11
AAA34284 Tri a gliadin 186 515 56.8 6.6e-10
AAB02788 Tri a glutenin 815 280 37.9 0.0014
CAA43331 Tri a glutenin 830 272 37.2 0.0023
CAA31396 Tri a glutenin 648 255 35.7 0.0052
CAA31395 Tri a glutenin 839 257 36.0 0.0055
P10388 Tri a 26.0101 839 257 36.0 0.0055
CAA43361 Tri a glutenin 705 247 35.1 0.0087
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 20.0101 Sequence ID: BAN29066

 Score = 183.7 bits 2041,  Expect = 6e-48
 Identities = 279/279 100%, Positives = 279/279 100%, Gaps = 0/279 0%
Query  1    NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ 60
            NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ
Sbjct  1    NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ 60
Query  61   PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ 120
            PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ
Sbjct  61   PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ 120
Query  121  QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ 180
            QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ
Sbjct  121  QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ 180
Query  181  QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQPQQPAQLE 240
            QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQPQQPAQLE
Sbjct  181  QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQPQQPAQLE 240
Query  241  AIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ 279
            AIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ
Sbjct  241  AIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ 279

Sequence Alignment: 2. Allergen Name: Tri a gliadin Sequence ID: BAA11251

 Score = 166.2 bits 1830,  Expect = 1e-42
 Identities = 248/279 88%, Positives = 263/279 94%, Gaps = 0/279 0%
Query  1    NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ 60
            N+QVDPS QVQWPQQQP PQPHQPFSQQPQQTFPQPQQTFPHQPQQQF QPQQPQQQF+Q
Sbjct  1    NIQVDPSGQVQWPQQQPFPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFSQPQQPQQQFIQ 60
Query  61   PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ 120
            PQQPFPQQPQQ YPQ+PQQPFPQTQQPQQ FPQSQQPQQ F QPQQQFPQPQQPQQSFPQ
Sbjct  61   PQQPFPQQPQQTYPQRPQQPFPQTQQPQQPFPQSQQPQQPFPQPQQQFPQPQQPQQSFPQ 120
Query  121  QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ 180
            QQP +IQ SLQQQ+NPCKNFLLQQCKPVSLVSSLWSMI P+SDCQVMRQQCCQQLAQIPQ
Sbjct  121  QQPSLIQQSLQQQLNPCKNFLLQQCKPVSLVSSLWSMILPRSDCQVMRQQCCQQLAQIPQ 180
Query  181  QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQPQQPAQLE 240
            QLQCAAIH+I+HSIIMQQEQQEQ+QG++IL+PL QQQQVGQGTLVQGQGIIQPQQPAQLE
Sbjct  181  QLQCAAIHSIVHSIIMQQEQQEQRQGVQILVPLSQQQQVGQGTLVQGQGIIQPQQPAQLE 240
Query  241  AIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ 279
             IRS VLQTL TMCNVYVPP CS I+APF+S+VAGIGGQ
Sbjct  241  VIRSSVLQTLATMCNVYVPPYCSTIRAPFASIVAGIGGQ 279

Sequence Alignment: 3. Allergen Name: Tri a gliadin Sequence ID: AAA34274

 Score = 160.1 bits 1756,  Expect = 9e-41
 Identities = 241/272 88%, Positives = 255/272 93%, Gaps = 7/272 2%
Query  1    NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ 60
            NMQ DPS QVQWPQQQP  QPHQPFSQQPQQ FPQPQQTFPHQPQQQFPQPQQPQQQFLQ
Sbjct  20   NMQADPSGQVQWPQQQPFLQPHQPFSQQPQQIFPQPQQTFPHQPQQQFPQPQQPQQQFLQ 79
Query  61   PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ 120
            P+QPFPQQPQQPYPQQPQQPFPQTQQPQQ FPQS+QPQQ    P   FPQPQQPQQSFPQ
Sbjct  80   PRQPFPQQPQQPYPQQPQQPFPQTQQPQQPFPQSKQPQQ----P---FPQPQQPQQSFPQ 132
Query  121  QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ 180
            QQP +IQ SLQQQ+NPCKNFLLQQCKPVSLVSSLWS+I P SDCQVMRQQCCQQLAQIPQ
Sbjct  133  QQPSLIQQSLQQQLNPCKNFLLQQCKPVSLVSSLWSIILPPSDCQVMRQQCCQQLAQIPQ 192
Query  181  QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQPQQPAQLE 240
            QLQCAAIH+++HSIIMQQEQQEQ QG++IL+PL QQQQVGQG LVQGQGIIQPQQPAQLE
Sbjct  193  QLQCAAIHSVVHSIIMQQEQQEQLQGVQILVPLSQQQQVGQGILVQGQGIIQPQQPAQLE 252
Query  241  AIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ 279
             IRSLVLQTLPTMCNVYVPP CS I+APF+S+VA IGGQ
Sbjct  253  VIRSLVLQTLPTMCNVYVPPYCSTIRAPFASIVASIGGQ 291

Sequence Alignment: 4. Allergen Name: Tri a gliadin Sequence ID: AAA34288

 Score = 157.5 bits 1726,  Expect = 4e-40
 Identities = 232/232 100%, Positives = 232/232 100%, Gaps = 0/232 0%
Query  1    NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ 60
            NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ
Sbjct  20   NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ 79
Query  61   PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ 120
            PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ
Sbjct  80   PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ 139
Query  121  QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ 180
            QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ
Sbjct  140  QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ 199
Query  181  QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQ 232
            QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQ
Sbjct  200  QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQ 251

Sequence Alignment: 5. Allergen Name: Tri a gliadin Sequence ID: AAA34289

 Score = 147.8 bits 1608,  Expect = 5e-37
 Identities = 241/279 86%, Positives = 263/279 94%, Gaps = 29/279 10%
Query  1    NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ 60
            N+QVDPS QVQW QQQ VPQ +QP+SQQPQQTFPQPQQTFPHQPQQQ PQPQQPQQ FLQ
Sbjct  20   NIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQ 79
Query  61   PQQPFPQQPQQPYPQ----------------------------QPQQPFPQTQQPQQLFP 92
            PQQPFPQQPQQP+PQ                            QPQQPFPQTQQPQQ FP
Sbjct  80   PQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFP 139
Query  93   QSQQPQQQFSQPQQQFPQPQQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVS 152
            Q QQPQQ F QPQQQ+PQPQQPQQSFPQQQ PFIQPSLQQQ+NPCKN LLQQ KP SLVS
Sbjct  140  QLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNPCKNILLQQSKPASLVS 199
Query  153  SLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQ-GMHILL 211
            SLWS+IWPQSDCQVMRQQCCQQLAQIPQQLQCAAIH+++HSIIMQQ+QQ+QQQ G+ I+L
Sbjct  200  SLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFL 259
Query  212  PLYQQQQVGQGTLVQGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPFSS 271
            PL Q++QVGQG+LVQGQGIIQPQQPAQLEAIRSLVLQTLP+MCNVYVPPECSI++APF+S
Sbjct  260  PLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFAS 319
Query  272  VVAGIGGQ 279
            +VAGIGGQ
Sbjct  320  IVAGIGGQ 327

Sequence Alignment: 6. Allergen Name: Tri a gliadin Sequence ID: AAA34272

 Score = 116.7 bits 1234,  Expect = 1e-27
 Identities = 221/268 82%, Positives = 238/268 88%, Gaps = 26/268 9%
Query  1    NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQ---------------QTFPQPQQTFPHQPQ 45
            NMQVDPS QVQWPQQQP PQP+QPF QQPQ               QTFPQPQQT+PHQPQ
Sbjct  20   NMQVDPSGQVQWPQQQPFPQPQQPFCQQPQRTIPQPHQTFHHQPQQTFPQPQQTYPHQPQ 79
Query  46   QQFPQPQQPQQQFLQPQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQ 105
            QQFPQ QQPQQ F QPQQ FPQQPQ P+PQQPQQPFPQ QQPQQ FPQSQQPQQ F QPQ
Sbjct  80   QQFPQTQQPQQPFPQPQQTFPQQPQLPFPQQPQQPFPQPQQPQQPFPQSQQPQQPFPQPQ 139
Query  106  QQFPQPQQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQ 165
            QQFPQPQQPQQSFPQQQ P IQ  LQQQ+NPCKNFLLQQC  VSLVSSL S+I P+SDCQ
Sbjct  140  QQFPQPQQPQQSFPQQQQPAIQSFLQQQMNPCKNFLLQQCNHVSLVSSLVSIILPRSDCQ 199
Query  166  VMRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLV 225
            VM+QQCCQQLAQIPQQLQCAAIH++ HSIIMQQEQQ   QG+ IL PL+Q        L 
Sbjct  200  VMQQQCCQQLAQIPQQLQCAAIHSVAHSIIMQQEQQ---QGVPILRPLFQ--------LA 248
Query  226  QGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ 279
            QG GIIQPQQPAQLE IRSLVL+TLPTMCNVYVPP+CS I  P++++ AGIGGQ
Sbjct  249  QGLGIIQPQQPAQLEGIRSLVLKTLPTMCNVYVPPDCSTINVPYANIDAGIGGQ 302

Sequence Alignment: 7. Allergen Name: Hor v 21 Sequence ID: P80198

 Score = 84.7 bits 848,  Expect = 4e-18
 Identities = 148/245 60%, Positives = 183/245 74%, Gaps = 37/245 15%
Query  27   QQPQQTFPQPQQTFPHQPQ--QQFPQPQQPQQQFLQPQQPFPQQPQQP----YPQQ-PQQ 79
            ++PQQ FPQ  Q +P+QP   QQ P+   PQQQ L  QQPFPQQPQ P    +PQQ PQQ
Sbjct  16   ERPQQLFPQ-WQPLPQQPPFLQQEPEQPYPQQQPLPQQQPFPQQPQLPHQHQFPQQLPQQ 74
Query  80   PFPQTQ--QPQQLFPQSQ--QPQQQFSQPQQQ-FPQPQQP--QQSFPQQQP-PFIQPSL- 130
             FPQ    QPQQ FPQ    QPQQQ   PQQ+ F Q QQP  QQ +PQQQP    QPS+ 
Sbjct  75   QFPQQMPLQPQQQFPQQMPLQPQQQPQFPQQKPFGQYQQPLTQQPYPQQQPLAQQQPSIE 134
Query  131  -QQQVNPCKNFLLQQC---KPVSLVSSLWSMIWP----QSDCQVMRQQCCQQLAQIPQQL 182
             Q+Q+N CK FLLQQC   + V L+ S+ S + P    Q+ CQ+ RQQCCQQLA I +Q 
Sbjct  135  EQHQLNLCKEFLLQQCTLDEKVPLLQSVISFLRPHISQQNSCQLKRQQCCQQLANINEQS 194
Query  183  QCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQ-----GQGIIQPQQPA 237
            +C AI+TI+H+I+MQ  QQ QQQ  H ++   Q QQ+GQG  +Q     GQ  + PQQ A
Sbjct  195  RCPAIQTIVHAIVMQ--QQVQQQVGHGFVQ-SQLQQLGQGMPIQLQQQPGQAFVLPQQQA 251
Query  238  QLEAIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ 279
            Q++ + SLV+QTLP +CNV+VPP CS    PF S+  G GGQ
Sbjct  252  QFKVVGSLVIQTLPMLCNVHVPPYCS----PFGSMATGSGGQ 289

Sequence Alignment: 8. Allergen Name: Hor v 20.0101 Sequence ID: P80198

 Score = 84.7 bits 848,  Expect = 4e-18
 Identities = 148/245 60%, Positives = 183/245 74%, Gaps = 37/245 15%
Query  27   QQPQQTFPQPQQTFPHQPQ--QQFPQPQQPQQQFLQPQQPFPQQPQQP----YPQQ-PQQ 79
            ++PQQ FPQ  Q +P+QP   QQ P+   PQQQ L  QQPFPQQPQ P    +PQQ PQQ
Sbjct  16   ERPQQLFPQ-WQPLPQQPPFLQQEPEQPYPQQQPLPQQQPFPQQPQLPHQHQFPQQLPQQ 74
Query  80   PFPQTQ--QPQQLFPQSQ--QPQQQFSQPQQQ-FPQPQQP--QQSFPQQQP-PFIQPSL- 130
             FPQ    QPQQ FPQ    QPQQQ   PQQ+ F Q QQP  QQ +PQQQP    QPS+ 
Sbjct  75   QFPQQMPLQPQQQFPQQMPLQPQQQPQFPQQKPFGQYQQPLTQQPYPQQQPLAQQQPSIE 134
Query  131  -QQQVNPCKNFLLQQC---KPVSLVSSLWSMIWP----QSDCQVMRQQCCQQLAQIPQQL 182
             Q+Q+N CK FLLQQC   + V L+ S+ S + P    Q+ CQ+ RQQCCQQLA I +Q 
Sbjct  135  EQHQLNLCKEFLLQQCTLDEKVPLLQSVISFLRPHISQQNSCQLKRQQCCQQLANINEQS 194
Query  183  QCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQ-----GQGIIQPQQPA 237
            +C AI+TI+H+I+MQ  QQ QQQ  H ++   Q QQ+GQG  +Q     GQ  + PQQ A
Sbjct  195  RCPAIQTIVHAIVMQ--QQVQQQVGHGFVQ-SQLQQLGQGMPIQLQQQPGQAFVLPQQQA 251
Query  238  QLEAIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ 279
            Q++ + SLV+QTLP +CNV+VPP CS    PF S+  G GGQ
Sbjct  252  QFKVVGSLVIQTLPMLCNVHVPPYCS----PFGSMATGSGGQ 289

Sequence Alignment: 9. Allergen Name: Tri a gliadin Sequence ID: CAA26383

 Score = 81.5 bits 810,  Expect = 4e-17
 Identities = 136/249 54%, Positives = 167/249 67%, Gaps = 31/249 12%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQQFLQPQQP 64
            P  Q Q P Q P PQ + P+ Q  QQ FP  QQ FP  PQQ +PQPQ  P QQ     QP
Sbjct  26   PQPQPQNPSQ-PQPQGQVPLVQ--QQQFPGQQQQFP--PQQPYPQPQPFPSQQPYLQLQP 80
Query  65   FPQQ----PQQPYPQ----QPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQ 116
            FPQ     PQ PYPQ     PQQP+PQ   PQ   PQ  QPQQ  SQ Q Q  Q QQ QQ
Sbjct  81   FPQPQPFPPQLPYPQPPPFSPQQPYPQ---PQ---PQYPQPQQPISQQQAQQQQQQQQQQ 134
Query  117  SFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLA 176
               QQQ   +Q  LQQQ+ PC++ +LQQ      ++   S +  QS  Q ++Q CCQQL 
Sbjct  135  QQQQQQQQILQQILQQQLIPCRDVVLQQHN----IAHARSQVLQQSTYQPLQQLCCQQLW 190
Query  177  QIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQ-VGQGTLV------QGQG 229
            QIP+Q +C AIH ++H+II++Q+Q++QQ   ++ L   QQQ   GQG +       Q QG
Sbjct  191  QIPEQSRCQAIHNVVHAIILHQQQRQQQPSSQVSLQQPQQQYPSGQGFFQPSQQNPQAQG 250
Query  230  IIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
             +QPQQ  Q+E IR+L LQTLP MCNVY+PP CS   APF
Sbjct  251  SVQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTIAPF 290

Sequence Alignment: 10. Allergen Name: Tri a gliadin Sequence ID: AAA34290

 Score = 81.4 bits 809,  Expect = 4e-17
 Identities = 136/249 54%, Positives = 166/249 66%, Gaps = 31/249 12%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQQFLQPQQP 64
            P  Q Q P Q P PQ + P+ Q  QQ FP  QQ FP  PQQ +PQPQ  P QQ     QP
Sbjct  26   PQPQPQNPSQ-PQPQRQVPLVQ--QQQFPGQQQQFP--PQQPYPQPQPFPSQQPYLQLQP 80
Query  65   FPQQ----PQQPYPQ----QPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQ 116
            FPQ     PQ PYPQ     PQQP+PQ   PQ   PQ  QPQQ  SQ Q Q  Q QQ QQ
Sbjct  81   FPQPQPFPPQLPYPQPPPFSPQQPYPQ---PQ---PQYPQPQQPISQQQAQQQQQQQQQQ 134
Query  117  SFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLA 176
               QQQ   +   LQQQ+ PC++ +LQQ      ++   S +  QS  Q ++Q CCQQL 
Sbjct  135  QQQQQQQQILPQILQQQLIPCRDVVLQQHN----IAHARSQVLQQSTYQPLQQLCCQQLW 190
Query  177  QIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQ-VGQGTLV------QGQG 229
            QIP+Q +C AIH ++H+II++Q+QQ+QQ   ++ L   QQQ   GQG +       Q QG
Sbjct  191  QIPEQSRCQAIHNVVHAIILHQQQQQQQPSSQVSLQQPQQQYPSGQGFFQPSQQNPQAQG 250
Query  230  IIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
             +QPQQ  Q+E IR+L LQTLP MCNVY+PP CS   APF
Sbjct  251  SVQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTTAPF 290

Sequence Alignment: 11. Allergen Name: Tri a gliadin Sequence ID: CAA26384

 Score = 78.6 bits 775,  Expect = 3e-16
 Identities = 139/240 57%, Positives = 175/240 72%, Gaps = 39/240 16%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQ-QFLQPQQ 63
            P  Q Q P QQ  PQ + P+ QQ QQ + Q QQ FP  PQQ +PQPQ  P Q  +LQ  Q
Sbjct  26   PQLQPQNPSQQQ-PQEQVPLVQQ-QQFLGQ-QQPFP--PQQPYPQPQPFPSQLPYLQ-LQ 79
Query  64   PFPQQPQQPY--PQQ--PQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFP 119
            PFPQ PQ PY  PQQ  PQQP+PQ   PQ   PQ  QPQQ  SQ QQQ  Q QQ QQ   
Sbjct  80   PFPQ-PQLPYSQPQQFRPQQPYPQ---PQ---PQYSQPQQPISQQQQQ--QQQQQQQQ-- 128
Query  120  QQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIP 179
            QQQ   +Q  LQQQ+ PC + +LQQ      ++   S +  QS  Q++++ CCQ+L QIP
Sbjct  129  QQQQQILQQILQQQLIPCMDVVLQQHN----IAHGRSQVLQQSTYQLLQELCCQHLWQIP 184
Query  180  QQLQCAAIHTIIHSIIMQQEQQEQQQG---MHILLPLYQQQQVGQGTLV------QGQGI 230
            +Q QC AIH ++H+II++Q+Q++QQQ    +    PL QQ  +GQG++       Q QG 
Sbjct  185  EQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPL-QQYPLGQGSFRPSQQNPQAQGS 243
Query  231  IQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
            +QPQQ  Q+E IR+L LQTLP MCNVY+PP C+I  APF
Sbjct  244  VQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTI--APF 280

Sequence Alignment: 12. Allergen Name: Tri a gliadin Sequence ID: CAA25261

 Score = 78.3 bits 771,  Expect = 4e-16
 Identities = 138/240 57%, Positives = 176/240 73%, Gaps = 39/240 16%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQ-QFLQPQQ 63
            P  Q Q P QQ +PQ + P+ QQ QQ + Q QQ FP  PQQ +PQPQ  P Q  +LQ  Q
Sbjct  26   PQLQPQNPSQQ-LPQEQVPLVQQ-QQFLGQ-QQPFP--PQQPYPQPQPFPSQLPYLQ-LQ 79
Query  64   PFPQQPQQPY--PQ--QPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFP 119
            PFPQ PQ PY  PQ  +PQQP+PQ   PQ   PQ  QPQQ  SQ QQQ  Q QQ QQ   
Sbjct  80   PFPQ-PQLPYSQPQPFRPQQPYPQ---PQ---PQYSQPQQPISQQQQQ--QQQQQQQQ-- 128
Query  120  QQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIP 179
            QQQ   +Q  LQQQ+ PC + +LQQ      ++   S +  QS  Q++++ CCQ+L QIP
Sbjct  129  QQQQQILQQILQQQLIPCMDVVLQQHN----IAHGRSQVLQQSTYQLLQELCCQHLWQIP 184
Query  180  QQLQCAAIHTIIHSIIMQQEQQEQQQG---MHILLPLYQQQQVGQGTLV------QGQGI 230
            +Q QC AIH ++H+II++Q+Q++QQQ    +    PL QQ  +GQG++       Q QG 
Sbjct  185  EQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPL-QQYPLGQGSFRPSQQNPQAQGS 243
Query  231  IQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
            +QPQQ  Q+E IR+L LQTLP MCNVY+PP C+I  APF
Sbjct  244  VQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTI--APF 280

Sequence Alignment: 13. Allergen Name: Tri a gliadin Sequence ID: AAA34280

 Score = 78.1 bits 769,  Expect = 4e-16
 Identities = 138/240 57%, Positives = 175/240 72%, Gaps = 39/240 16%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQ-QFLQPQQ 63
            P  Q Q P QQ  PQ + P+ QQ QQ + Q QQ FP  PQQ +PQPQ  P Q  +LQ  Q
Sbjct  26   PQLQPQNPSQQQ-PQEQVPLVQQ-QQFLGQ-QQPFP--PQQPYPQPQPFPSQLPYLQ-LQ 79
Query  64   PFPQQPQQPY--PQ--QPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFP 119
            PFPQ PQ PY  PQ  +PQQP+PQ   PQ   PQ  QPQQ  SQ QQQ  Q QQ QQ   
Sbjct  80   PFPQ-PQLPYSQPQPFRPQQPYPQ---PQ---PQYSQPQQPISQQQQQ--QQQQQQQQ-- 128
Query  120  QQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIP 179
            QQQ   +Q  LQQQ+ PC + +LQQ      ++   S +  QS  Q++++ CCQ+L QIP
Sbjct  129  QQQQQILQQILQQQLIPCMDVVLQQHN----IAHGRSQVLQQSTYQLLQELCCQHLWQIP 184
Query  180  QQLQCAAIHTIIHSIIMQQEQQEQQQG---MHILLPLYQQQQVGQGTLV------QGQGI 230
            +Q QC AIH ++H+II++Q+Q++QQQ    +    PL QQ  +GQG++       Q QG 
Sbjct  185  EQSQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPL-QQYPLGQGSFRPSQQNPQAQGS 243
Query  231  IQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
            +QPQQ  Q+E IR+L LQTLP MCNVY+PP C+I  APF
Sbjct  244  VQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTI--APF 280

Sequence Alignment: 14. Allergen Name: Tri a gliadin Sequence ID: AAA34283

 Score = 77.3 bits 759,  Expect = 7e-16
 Identities = 131/235 55%, Positives = 166/235 70%, Gaps = 36/235 15%
Query  17   PVPQ--PHQPFSQQPQQTFP--QPQQTFPHQPQQQFPQPQQPQQQFLQPQQPFPQQPQQP 72
            PVPQ  P+ P  QQPQ+  P  Q QQ FP Q Q+QFP PQQP  +    QQPFP   QQP
Sbjct  24   PVPQLQPQNPSQQQPQEQVPLMQQQQQFPGQ-QEQFP-PQQPYPH----QQPFPS--QQP 75
Query  73   YPQQPQQPFPQTQQPQQLFPQSQQ--PQQQFSQPQQQFPQPQQP----QQSFPQQQPPFI 126
            YPQ PQ PFP    PQ  +PQ+Q   PQQ + QPQ Q+PQPQQP    Q    QQQ   +
Sbjct  76   YPQ-PQ-PFP----PQLPYPQTQPFPPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQTL 129
Query  127  QPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQCAA 186
            Q  LQQQ+ PC++ +LQQ   ++  SS    +  QS  Q ++Q CCQQL QIP+Q +C A
Sbjct  130  QQILQQQLIPCRDVVLQQ-HNIAHASS---QVLQQSSYQQLQQLCCQQLFQIPEQSRCQA 185
Query  187  IHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLV--------QGQGIIQPQQPAQ 238
            IH ++H+II+++ QQ+QQQ    +     Q+Q   G +         Q QG +QPQQ  Q
Sbjct  186  IHNVVHAIILHHHQQQQQQPSSQVSYQQPQEQYPSGQVSFQSSQQNPQAQGSVQPQQLPQ 245
Query  239  LEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
            ++ IR+L LQTLP MCNVY+PP CS   APF
Sbjct  246  FQEIRNLALQTLPAMCNVYIPPYCSTTIAPF 276

Sequence Alignment: 15. Allergen Name: Tri a gliadin Sequence ID: AAA17741

 Score = 77.0 bits 756,  Expect = 9e-16
 Identities = 137/243 56%, Positives = 170/243 69%, Gaps = 34/243 13%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQQFLQPQQP 64
            P  Q Q P QQ  PQ + P+ QQ QQ + Q QQ FP  PQQ +PQPQ  P QQ     QP
Sbjct  26   PQLQPQNPSQQQ-PQEQVPLVQQ-QQFLGQ-QQPFP--PQQPYPQPQPFPSQQPYLQLQP 80
Query  65   F--PQQP-QQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQ 121
            F  PQ P  QP P +PQQP+PQ   PQ   PQ  QPQQ  SQ QQQ  Q QQ QQ   QQ
Sbjct  81   FLQPQLPYSQPQPFRPQQPYPQ---PQ---PQYSQPQQPISQQQQQQQQQQQQQQ---QQ 131
Query  122  QPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQ 181
            Q   IQ  LQQQ+ PC + +LQQ   V   S     +  QS  Q++++ CCQ+L QIP+Q
Sbjct  132  QQQIIQQILQQQLIPCMDVVLQQHNIVHGKSQ----VLQQSTYQLLQELCCQHLWQIPEQ 187
Query  182  LQCAAIHTIIHSIIMQQEQQEQQQG---MHILLPLYQQQQVGQGTLV------QGQGIIQ 232
             QC AIH ++H+II++Q+Q++QQQ    +    PL QQ  +GQG++       Q QG +Q
Sbjct  188  SQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPL-QQYPLGQGSFRPSQQNPQAQGSVQ 246
Query  233  PQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
            PQQ  Q+E IR+L LQTLP MCNVY+PP C+I  APF
Sbjct  247  PQQLPQFEEIRNLALQTLPAMCNVYIPPYCTI--APF 281

Sequence Alignment: 16. Allergen Name: Tri a gliadin Sequence ID: CAA25593

 Score = 76.9 bits 755,  Expect = 9e-16
 Identities = 137/240 57%, Positives = 174/240 72%, Gaps = 39/240 16%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQ-QFLQPQQ 63
            P  Q Q P QQ  PQ + P+ QQ QQ + Q QQ FP  PQQ +PQPQ  P Q  +LQ  Q
Sbjct  26   PQLQPQNPSQQQ-PQEQVPLVQQ-QQFLGQ-QQPFP--PQQPYPQPQPFPSQLPYLQ-LQ 79
Query  64   PFPQQPQQPY--PQ--QPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFP 119
            PFPQ PQ PY  PQ  +PQQP+PQ   PQ   PQ  QPQQ  SQ QQQ  Q QQ QQ   
Sbjct  80   PFPQ-PQLPYSQPQPFRPQQPYPQ---PQ---PQYSQPQQPISQQQQQ--QQQQQQQQ-- 128
Query  120  QQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIP 179
            QQQ   +Q  LQQQ+ PC + +LQQ      ++   S +  QS  Q++++ CCQ+L QIP
Sbjct  129  QQQQQILQQILQQQLIPCMDVVLQQHN----IAHGRSQVLQQSTYQLLQELCCQHLWQIP 184
Query  180  QQLQCAAIHTIIHSIIMQQEQQEQQQG---MHILLPLYQQQQVGQGTLV------QGQGI 230
            +Q QC AI  ++H+II++Q+Q++QQQ    +    PL QQ  +GQG++       Q QG 
Sbjct  185  EQSQCQAILKVVHAIILHQQQKQQQQPSSQVSFQQPL-QQYPLGQGSFRPSQQNPQAQGS 243
Query  231  IQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
            +QPQQ  Q+E IR+L LQTLP MCNVY+PP C+I  APF
Sbjct  244  VQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTI--APF 280

Sequence Alignment: 17. Allergen Name: Tri a gliadin Sequence ID: CAA35238

 Score = 73.0 bits 707,  Expect = 2e-14
 Identities = 144/247 58%, Positives = 181/247 73%, Gaps = 44/247 17%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQQ------- 57
            P  Q Q P QQ  PQ + P+ Q  QQ FP  QQ FP  PQQ +PQPQ  P QQ       
Sbjct  26   PQLQPQNPSQQQ-PQEQVPLVQ--QQQFPGQQQPFP--PQQPYPQPQPFPSQQPYLQLQP 80
Query  58   FLQPQQPFPQQPQQPYPQQPQQPFPQTQ--QPQQLFPQSQ----QPQQQFSQPQQQFPQP 111
            F QPQ P+PQ PQ PYPQ PQ P+PQ Q  +PQQ +PQSQ    QPQQ  SQ QQQ  Q 
Sbjct  81   FPQPQLPYPQ-PQLPYPQ-PQLPYPQPQPFRPQQPYPQSQPQYSQPQQPISQQQQQ-QQQ 137
Query  112  QQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQC 171
            QQ Q+   QQQ   +Q  LQQQ+ PC++ +LQQ   ++  SS    +  QS  Q+++Q C
Sbjct  138  QQQQKQQQQQQQQILQQILQQQLIPCRDVVLQQ-HSIAYGSS---QVLQQSTYQLVQQLC 193
Query  172  CQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQ------QQQV--GQGT 223
            CQQL QIP+Q +C AIH ++H+II++Q+QQ+QQQ  +   PL Q      QQQ   GQG+
Sbjct  194  CQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQQQ--QPLSQVSFQQPQQQYPSGQGS 251
Query  224  LV------QGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAP 268
            +       Q QG +QPQQ  Q+E IR+L L+TLP MCNVY+PP C+I  AP
Sbjct  252  FQPSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTI--AP 300

Sequence Alignment: 18. Allergen Name: Tri a gliadin Sequence ID: AAA34282

 Score = 72.6 bits 703,  Expect = 2e-14
 Identities = 141/245 57%, Positives = 178/245 72%, Gaps = 38/245 15%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQP---QQQFLQPQ 62
            P  Q Q P QQ  PQ + P+ Q  QQ FP  QQ FP  PQQ +PQ QQP   QQ ++Q  
Sbjct  26   PQLQPQNPSQQQ-PQKQVPLVQ--QQQFPGQQQPFP--PQQPYPQ-QQPFPSQQPYMQ-L 78
Query  63   QPFPQQPQQPYPQQPQQPFPQTQ--QPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ 120
            QPFPQ PQ PYPQ PQ P+PQ Q  +PQQ +PQ   PQ Q+SQPQQ   Q QQ QQ   Q
Sbjct  79   QPFPQ-PQLPYPQ-PQLPYPQPQPFRPQQSYPQ---PQPQYSQPQQPISQQQQQQQQQQQ 133
Query  121  QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ 180
            QQ   +Q  LQQQ+ PC++ +LQQ      ++   S +  QS  Q+++Q CCQQL QIP+
Sbjct  134  QQQQILQQILQQQLIPCRDVVLQQHS----IAHGSSQVLQQSTYQLVQQFCCQQLWQIPE 189
Query  181  QLQCAAIHTIIHSIIM-QQEQQEQQQGMHILLPLYQ------QQQV--GQGTLV------ 225
            Q +C AIH ++H+II+ QQ+QQ+QQQ  +   PL Q      QQQ   GQG++       
Sbjct  190  QSRCQAIHNVVHAIILHQQQQQQQQQQQQQQQPLSQVCFQQSQQQYPSGQGSFQPSQQNP 249
Query  226  QGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAP 268
            Q QG +QPQQ  Q+E IR+L L+TLP MCNVY+PP C+I  AP
Sbjct  250  QAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTI--AP 290

Sequence Alignment: 19. Allergen Name: Tri a 36.0101 Sequence ID: AEH31546

 Score = 72.0 bits 695,  Expect = 3e-14
 Identities = 149/272 54%, Positives = 176/272 64%, Gaps = 37/272 13%
Query  3    QVDP-SSQVQWP----QQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQ 57
            Q  P S Q Q P    QQ P  Q + PFSQQ QQ + Q QQ  P   QQQ P  QQ Q  
Sbjct  62   QQQPCSQQQQQPLSQQQQPPFSQQQPPFSQQQQQPLSQQQQ--PPFSQQQPPFSQQQQPP 119
Query  58   FLQPQQPFPQQPQQPYPQQP---QQ---PFPQTQQP----QQLFPQSQQP---QQQFSQP 104
            F Q Q PF QQ Q   PQQP   QQ   PF Q Q P    QQ+  Q Q P   QQQ S P
Sbjct  120  FSQQQPPFSQQQQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLP 179
Query  105  QQQFPQPQQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLW-SMIWPQSD 163
            QQ     QQ Q  +PQQQ PF++PS+ QQ+NPCK FL QQC PV++  SL  S +  QS 
Sbjct  180  QQPPFSQQQQQLVLPQQQIPFVHPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLQQSS 239
Query  164  CQVMRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQ-----------EQQQGMHILLP 212
            C+VM+QQCCQQL QIPQQ +  AI  II+SII+Q++QQ            QQ G  +  P
Sbjct  240  CHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQP 299
Query  213  LYQ-QQQVGQGTLVQ--GQG-IIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAP 268
              Q QQQ+GQ    Q   QG  +QP+Q AQLE + S+ L+TLPTMC V VP   +    P
Sbjct  300  QQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTSVP 359
Query  269  FSSVVAGIG 277
            F  V  G+G
Sbjct  360  FG-VGTGVG 367

Sequence Alignment: 20. Allergen Name: Tri a glutenin Sequence ID: CAA31685

 Score = 70.7 bits 680,  Expect = 7e-14
 Identities = 143/258 55%, Positives = 172/258 66%, Gaps = 35/258 13%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQPQQPF 65
            P  +  W QQQP+P P+Q F QQP  +  Q QQ FP+QP   F Q Q P   F Q Q PF
Sbjct  27   PGLERPW-QQQPLP-PQQTFPQQPLFSQQQQQQLFPQQPS--FSQQQPP---FWQQQPPF 79
Query  66   PQQPQQPY-PQQPQQPFPQTQQ---PQQLFPQSQQPQQQFSQPQQQ-FPQPQQPQQSFPQ 120
             Q  QQP  PQQP  PF Q QQ   PQQ  P   Q QQ    PQQ  FPQ QQ +Q + Q
Sbjct  80   SQ--QQPILPQQP--PFSQQQQLVLPQQ--PPFSQQQQPVLPPQQSPFPQQQQQHQQLVQ 133
Query  121  QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLW-SMIWPQSDCQVMRQQCCQQLAQIP 179
            QQ P +QPS+ QQ+NPCK FL QQC PV++   L  S +  QS C+VM+QQCCQQL QIP
Sbjct  134  QQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIP 193
Query  180  QQLQCAAIHTIIHSIIMQ-----------QEQQEQQQGMHILLPLYQ-QQQVGQGTLVQ- 226
            QQ +  AI  II+SII+Q           Q+QQ QQ G  +  P  Q QQQ+GQ    Q 
Sbjct  194  QQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQ 253
Query  227  -GQG-IIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIG 277
              QG  +QP+Q AQLE + S+ L+ LPTMC+V VP   +    PF  V  G+G
Sbjct  254  LAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFG-VGTGVG 305

Sequence Alignment: 21. Allergen Name: Tri a glutenin Sequence ID: CAA30570

 Score = 70.5 bits 676,  Expect = 1e-13
 Identities = 157/272 57%, Positives = 185/272 68%, Gaps = 60/272 22%
Query  3    QVDPSSQVQWP-----QQQPVPQPHQ-PFSQQPQQT-FPQPQQT-FPHQP----QQQFPQ 50
            Q  P SQ Q P     QQ P  Q +Q PFSQQ QQ  F Q QQ  F +QP    QQQ P 
Sbjct  26   QAPPFSQQQQPPFSQQQQPPFSQQQQSPFSQQQQQPPFAQQQQPPFSQQPPISQQQQPPF 85
Query  51   PQQPQQQFLQPQQP-FPQQPQQPYPQQPQQPFPQTQQP-----QQLFPQSQQPQQQFSQP 104
             QQ Q QF Q QQP + QQ Q PY QQ Q PF Q QQP     QQ  P +QQ QQQ  Q 
Sbjct  86   SQQQQPQFSQQQQPPYSQQQQPPYSQQQQPPFSQQQQPPFSQQQQQPPFTQQQQQQ--QQ 143
Query  105  QQQFPQPQQP--QQSFP---QQQPPFIQ----------------PSLQQQVNPCKNFLLQ 143
            QQ F Q QQP   Q  P   QQQPPF+Q                PS+ QQ+NPCK FL Q
Sbjct  144  QQPFTQQQQPPFSQQPPISQQQQPPFLQQQRPPFSRQQQIPVIHPSVLQQLNPCKVFLQQ 203
Query  144  QCKPVSLVSSLW-SMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQE 202
            QC PV++   L  S +  QS C+VM+QQCCQQL QIP+Q +  +I  II+SII+QQ+QQ+
Sbjct  204  QCIPVAMQRCLARSQMLQQSICHVMQQQCCQQLRQIPEQSRHESIRAIIYSIILQQQQQQ 263
Query  203  QQQ-----GMHILLPLYQQ-QQVGQGT-----LVQGQGIIQPQQP------AQLEAIRSL 245
            QQQ     G  I+    QQ QQ+GQ        +Q Q   QPQQ       AQLE + S+
Sbjct  264  QQQQQQQQGQSIIQYQQQQPQQLGQCVSQPLQQLQQQLGQQPQQQQLAHQIAQLEVMTSI 323
Query  246  VLQTLPTMCNVYVPPECSIIKAPFSSVVAGIG 277
             L+TLPTMCNV VP   +    P+  V  G+G
Sbjct  324  ALRTLPTMCNVNVPLYETTTSVPLG-VGIGVG 354

Sequence Alignment: 22. Allergen Name: Tri a glutenin Sequence ID: CAA59339

 Score = 69.2 bits 663,  Expect = 2e-13
 Identities = 124/215 57%, Positives = 144/215 66%, Gaps = 32/215 14%
Query  6    PSSQVQW-PQQQPVPQPHQPFSQQP----QQTFPQPQQTFPHQPQQQ--FPQPQQP---- 54
            P  Q+ W  QQQP+ Q  QPF QQP    QQ  P  QQ  P   QQQ  F Q QQP    
Sbjct  15   PLQQILWYQQQQPIQQQPQPFPQQPPCSQQQQPPLSQQQQPPFSQQQPPFSQQQQPILPQ 74
Query  55   QQQFLQPQQPFPQQPQQPYPQQPQQPFPQTQQP----QQLFPQSQQPQQQFSQPQQQFPQ 110
            Q  F Q QQ FPQQ Q   PQQP  PF Q Q P    QQ  P SQQ QQ     Q  F Q
Sbjct  75   QPPFSQQQQQFPQQQQPLLPQQP--PFSQQQPPFSQQQQQPPFSQQQQQPILLQQPPFSQ 132
Query  111  PQQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLW--SMIWPQSDCQVMR 168
             QQP   +PQQQ P +QPS+ QQ+NPCK FL QQC PV++  SL    M+W QS C+VM+
Sbjct  133  HQQP--VLPQQQIPSVQPSILQQLNPCKVFLQQQCSPVAMPQSLARSQMLW-QSSCHVMQ 189
Query  169  QQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQ 228
            QQCC+QL QIP+Q +  AI  II+SI++Q    EQQ+G  +  P  QQQQ  Q      Q
Sbjct  190  QQCCRQLPQIPEQSRYDAIRAIIYSIVLQ----EQQHGQGLNQP--QQQQPQQSV----Q 239
Query  229  GIIQPQQ 235
            G+ QPQQ
Sbjct  240  GVSQPQQ 246

Sequence Alignment: 23. Allergen Name: Tri a glutenin Sequence ID: CAA59340

 Score = 68.8 bits 657,  Expect = 2e-13
 Identities = 129/217 59%, Positives = 150/217 69%, Gaps = 43/217 19%
Query  6    PSSQVQW-PQQQPVPQPHQPFSQQP----QQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ 60
            P  Q+ W  QQQP+ Q  QPF QQP    QQ  P  QQ  P   QQQ P  QQ +   L 
Sbjct  15   PLQQILWYHQQQPIQQQPQPFPQQPPCSQQQQPPLSQQQQPPFSQQQPPFSQQ-ELPILP 73
Query  61   PQQPFPQQPQQPYPQQPQQPFPQTQQP---------QQLFPQSQQ------PQQQ-FSQP 104
             Q PF QQ QQP   Q QQPFPQ QQP         QQ  P SQQ      PQQ  FSQ 
Sbjct  74   QQPPFSQQ-QQPQFSQQQQPFPQQQQPLLLQQPPFSQQRPPFSQQQQQPVLPQQPPFSQQ 132
Query  105  QQQFP-QPQQP------QQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLW-- 155
            QQQ P  PQQP      Q  +PQQQ P++QPS+ QQ+NPCK FL QQC PV++  SL   
Sbjct  133  QQQQPILPQQPPFSLHQQPVLPQQQIPYVQPSILQQLNPCKVFLQQQCSPVAMPQSLARS 192
Query  156  SMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQ 215
             M+W QS C+VM+QQCCQQL +IP+Q +  AI  II+SI++Q    EQQ+G     P  Q
Sbjct  193  QMLW-QSSCHVMQQQCCQQLPRIPEQSRYDAIRAIIYSIVLQ----EQQHGQGFNQP--Q 245
Query  216  QQQVGQGTLVQGQGIIQPQQ 235
            QQQ  Q      QG+ QPQQ
Sbjct  246  QQQPQQSV----QGVSQPQQ 261

Sequence Alignment: 24. Allergen Name: Tri a gliadin Sequence ID: AAA34278

 Score = 68.1 bits 648,  Expect = 5e-13
 Identities = 144/251 57%, Positives = 176/251 70%, Gaps = 63/251 25%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQQ-FLQPQQ 63
            P  Q Q P QQ  PQ + P+ QQ Q  FP  QQ FP  PQQ +PQPQ  P QQ +LQ  Q
Sbjct  26   PQLQPQNPSQQQ-PQEQVPLVQQQQ--FPGQQQQFP--PQQPYPQPQPFPSQQPYLQ-LQ 79
Query  64   PFPQQPQQPYPQQPQQPFPQTQQ--PQQLFPQSQ----QPQQQFSQPQQQFPQPQQPQQS 117
            PFPQ PQ P+P  PQ P+PQ Q   PQQ +PQ Q    QPQQ  SQ Q Q  Q QQ QQ 
Sbjct  80   PFPQ-PQ-PFP--PQLPYPQPQSFPPQQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQ- 134
Query  118  FPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQ 177
              QQQ   +Q  LQQQ+ PC++ +LQQ   ++  SS    +  QS  Q+++Q CCQQL Q
Sbjct  135  --QQQQQILQQILQQQLIPCRDVVLQQ-HNIAHASS---QVLQQSTYQLLQQLCCQQLLQ 188
Query  178  IPQQLQCAAIHTIIHSIIM-QQEQQEQQQGMHILLPLYQQQQVGQ---------GTLV-- 225
            IP+Q QC AIH + H+IIM QQ+QQ+Q+Q  ++     QQQQ+ Q          + V  
Sbjct  189  IPEQSQCQAIHNVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSF 248
Query  226  ---------------------QGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSI 264
                                 Q QG +QPQQ  Q+  IR+L LQTLP MCNVY+PP CS 
Sbjct  249  QQPQQQYPSSQVSFQPSQLNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCST 308
Query  265  IKAPFSSVVAGIGG 278
              APF     GI G
Sbjct  309  TIAPF-----GISG 317

Sequence Alignment: 25. Allergen Name: Tri a glutenin Sequence ID: CAA44473

 Score = 67.2 bits 638,  Expect = 8e-13
 Identities = 134/245 54%, Positives = 171/245 69%, Gaps = 52/245 21%
Query  2    MQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQP 61
            + V  +S +       +P   +P+ QQP   +P PQQTFP+QP      P   QQQ    
Sbjct  10   LAVVATSAIAQMDTSCIPGLERPWQQQP---LP-PQQTFPQQP------PFSQQQQ---- 55
Query  62   QQPFPQQP----QQPY-PQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQ 116
            QQPFPQQP    QQP  PQ P  PFPQ  QP  ++PQ Q P   FSQ QQQ+  P Q QQ
Sbjct  56   QQPFPQQPSFSQQQPILPQGP--PFPQQTQP--VLPQ-QSP---FSQ-QQQLILPPQQQQ 106
Query  117  SFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLW-SMIWPQSDCQVMRQQCCQQL 175
             +PQQQ   +QPS+ QQ+NPCK FL QQC PV++   L  S +W QS C+VM+QQCCQQL
Sbjct  107  QLPQQQISIVQPSVLQQLNPCKVFLQQQCSPVAIPQRLARSQMWQQSSCHVMQQQCCQQL 166
Query  176  AQIPQQLQCAAIHTIIHSIIMQ-------QEQQEQQQGMHILLPLYQ-QQQVGQGTLVQG 227
            +QIP+Q +  AI  I +SII+Q       Q+QQ QQ G  +     Q QQQ+GQ ++ Q 
Sbjct  167  SQIPEQSRYDAIRAITYSIILQEQQQGQSQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQP 226
Query  228  QG---------------IIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
            Q                 +QP+Q A+LE + S+ L+TLPTMC+V VP   S    PF
Sbjct  227  QQQLGQQPQQQQVQQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPLYSSTTSVPF 283

Sequence Alignment: 26. Allergen Name: Tri a gliadin Sequence ID: AAA34275

 Score = 67.3 bits 638,  Expect = 8e-13
 Identities = 144/249 57%, Positives = 174/249 69%, Gaps = 66/249 26%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQQ-FLQPQQ 63
            P  Q Q P QQ  PQ + P+ QQ Q  FP  QQ FP  PQQ +PQPQ  P QQ +LQ  Q
Sbjct  26   PQLQPQNPSQQQ-PQEQVPLVQQQQ--FPGQQQQFP--PQQPYPQPQPFPSQQPYLQ-LQ 79
Query  64   PFPQQ---PQQPYPQQ----PQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQ 116
            PFPQ    P  PYPQ     PQQP+PQ QQPQ L     QPQQ  SQ Q Q  Q QQ QQ
Sbjct  80   PFPQPQPFPPLPYPQPQSFPPQQPYPQ-QQPQYL-----QPQQPISQQQAQQQQQQQQQQ 133
Query  117  SFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLA 176
               QQQ   +Q  LQQQ+ PC++ +LQQ   ++  SS    +  QS  Q+++Q CCQQL 
Sbjct  134  ---QQQQQILQQILQQQLIPCRDVVLQQ-HNIAHASS---QVLQQSTYQLLQQLCCQQLL 186
Query  177  QIPQQLQCAAIHTIIHSIIM-QQEQQEQQQGMHILLPLYQQQQVGQ---------GTLV- 225
            QIP+Q QC AIH + H+IIM QQ+QQ+Q+Q  ++     QQQQ+ Q          + V 
Sbjct  187  QIPEQSQCQAIHNVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVS 246
Query  226  ----------------------QGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECS 263
                                  Q QG +QPQQ  Q+  IR+L LQTLP MCNVY+PP CS
Sbjct  247  FQQPQQQYPSSQVSFQPSQLNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCS 306
Query  264  IIKAPFSSVVAGIGG 278
               APF     GI G
Sbjct  307  TTIAPF-----GISG 316

Sequence Alignment: 27. Allergen Name: Tri a gliadin Sequence ID: AAA34281

 Score = 66.8 bits 633,  Expect = 1e-12
 Identities = 120/221 54%, Positives = 151/221 68%, Gaps = 32/221 14%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQQFLQPQQP 64
            P  Q Q P QQ  PQ + P+ QQ QQ + Q QQ FP  PQQ +PQPQ  P QQ     QP
Sbjct  26   PQLQPQNPSQQQ-PQEQVPLVQQ-QQFLGQ-QQPFP--PQQPYPQPQPFPSQQPYLQLQP 80
Query  65   F--PQQP-QQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQ 121
            F  PQ P  QP P +PQQP+PQ   PQ   PQ  QPQQ  SQ QQQ  Q QQ QQ   QQ
Sbjct  81   FLQPQLPYSQPQPFRPQQPYPQ---PQ---PQYSQPQQPISQQQQQQQQQQQQQQ---QQ 131
Query  122  QPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQ 181
            Q   IQ  LQQQ+ PC + +LQQ   V       S +  QS  Q++++ CCQ+L QIP+Q
Sbjct  132  QQQIIQQILQQQLIPCMDVVLQQHNIVHGK----SQVLQQSTYQLLQELCCQHLWQIPEQ 187
Query  182  LQCAAIHTIIHSIIMQQEQQEQQQG---MHILLPLYQQQQVGQGTLV------QGQGIIQ 232
             QC AIH ++H+II++Q+Q++QQQ    +    PL QQ  +GQG++       Q QG +Q
Sbjct  188  SQCQAIHNVVHAIILHQQQKQQQQPSSQVSFQQPL-QQYPLGQGSFRPSQQNPQAQGSVQ 246
Query  233  PQQPAQLEAIRSL 245
            PQQ  Q+E IR+L
Sbjct  247  PQQLPQFEEIRNL 259

Sequence Alignment: 28. Allergen Name: Tri a gliadin Sequence ID: AAA34279

 Score = 66.7 bits 632,  Expect = 1e-12
 Identities = 140/251 55%, Positives = 169/251 67%, Gaps = 48/251 19%
Query  9    QVQWPQQQPV-PQPHQPFSQQP---QQTFPQPQQTFPHQPQQQFPQPQQ-PQQQ-FLQPQ 62
            +V  PQ QP  P  +QP  Q P   QQ FP  QQ FP  PQQ +PQPQ  P QQ +LQ  
Sbjct  19   RVPVPQLQPKNPSQQQPQEQVPLVQQQQFPGQQQQFP--PQQPYPQPQPFPSQQPYLQ-L 75
Query  63   QPFPQQ----PQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSF 118
            QPFPQ     PQ PYPQ PQ   PQ   PQQ  P+  QPQQ  SQ Q Q  Q QQ QQ  
Sbjct  76   QPFPQPQPFLPQLPYPQ-PQSFPPQQPYPQQR-PKYLQPQQPISQQQAQ-QQQQQQQQQQ 132
Query  119  PQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQI 178
             QQQ   +Q  LQQQ+ PC++ +LQQ      ++   S +  QS  Q+++Q CCQQL QI
Sbjct  133  QQQQQQILQQILQQQLIPCRDVVLQQHN----IAHASSQVLQQSTYQLLQQLCCQQLLQI 188
Query  179  PQQLQCAAIHTIIHSIIM-QQEQQEQ-QQGMHILLPLYQQQQ------------------ 218
            P+Q +C AIH ++H+IIM QQEQQ+Q QQ  +  L   QQQQ                  
Sbjct  189  PEQSRCQAIHNVVHAIIMHQQEQQQQLQQQQQQQLQQQQQQQQQQQQPSSQVSFQQPQQQ 248
Query  219  --VGQGTLV------QGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
                QG++       Q QG +QPQQ  Q+  IR+L LQTLP MCNVY+PP CS   APF
Sbjct  249  YPSSQGSFQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPF 307

Sequence Alignment: 29. Allergen Name: Tri a gliadin Sequence ID: CAA26385

 Score = 66.6 bits 630,  Expect = 1e-12
 Identities = 141/242 58%, Positives = 171/242 70%, Gaps = 56/242 23%
Query  17   PVPQ--PHQPFSQQPQQTFPQ-PQQTFPHQPQQQFPQPQQPQQQFLQPQQPFP-QQPQ-- 70
            PVPQ  P  P  QQPQ+  P   QQ FP Q QQQFP PQQP   + QPQ PFP QQP   
Sbjct  21   PVPQLQPKNPSQQQPQEQVPLVQQQQFPGQ-QQQFP-PQQP---YPQPQ-PFPSQQPYLQ 74
Query  71   -QPYPQQ----PQQPFPQTQQ--PQQLFPQSQ----QPQQQFSQPQQQFPQPQQPQQSFP 119
             QP+PQ     PQ P+PQ Q   PQQ +PQ +    QPQQ  SQ Q Q  Q QQ QQ   
Sbjct  75   LQPFPQPQPFLPQLPYPQPQSFPPQQPYPQQRPMYLQPQQPISQQQAQ-QQQQQQQQQQQ 133
Query  120  QQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIP 179
            QQQ   +Q  LQQQ+ PC++ +LQQ   ++  SS    +  QS  Q+++Q CCQQL QIP
Sbjct  134  QQQQQILQQILQQQLIPCRDVVLQQ-HNIAHASS---QVLQQSTYQLLQQLCCQQLLQIP 189
Query  180  QQLQCAAIHTIIHSIIM-QQEQQEQ-QQGMHILLPLYQQQQ------------------- 218
            +Q +C AIH ++H+IIM QQEQQ+Q QQ  +  L   QQQQ                   
Sbjct  190  EQSRCQAIHNVVHAIIMHQQEQQQQLQQQQQQQLQQQQQQQQQQQQPSSQVSFQQPQQQY 249
Query  219  -VGQGTLV------QGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
               QG++       Q QG +QPQQ  Q+  IR+L LQTLP MCNVY+PP CS   APF
Sbjct  250  PSSQGSFQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPF 307

Sequence Alignment: 30. Allergen Name: Tri a gliadin Sequence ID: AAA34276

 Score = 66.5 bits 629,  Expect = 1e-12
 Identities = 134/243 55%, Positives = 169/243 69%, Gaps = 38/243 15%
Query  6    PSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQ-PQQQFLQPQQP 64
            P  Q+Q P QQ  PQ + P+ Q  +Q F   QQ FP  PQQ +PQPQ  P QQ     QP
Sbjct  26   PQLQLQNPSQQQ-PQEQVPLVQ--EQQFQGQQQPFP--PQQPYPQPQPFPSQQPYLQLQP 80
Query  65   FPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQQPP 124
            FPQ PQ PYPQ PQ PF    +PQQ +P   QPQ Q+SQPQQ   Q QQ QQ   QQQ  
Sbjct  81   FPQ-PQLPYPQ-PQ-PF----RPQQPYP---QPQPQYSQPQQPISQQQQQQQQQQQQQQQ 130
Query  125  FIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQC 184
             +Q  LQQQ+ PC++ +LQQ      ++   S +  +S  Q+++Q CCQQL QIP+Q +C
Sbjct  131  ILQQILQQQLIPCRDVVLQQHN----IAHGSSQVLQESTYQLVQQLCCQQLWQIPEQSRC 186
Query  185  AAIHTIIHSIIM--------QQEQQEQQQGMHILLPLYQQQQV--GQGTLV------QGQ 228
             AIH ++H+II+        QQ+QQ+QQQ +  +     QQQ   GQG +       Q Q
Sbjct  187  QAIHNVVHAIILHQQHHHHQQQQQQQQQQPLSQVSFQQPQQQYPSGQGFFQPSQQNPQAQ 246
Query  229  GIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
            G  QPQQ  Q+E IR+L LQTLP MCNVY+PP C+I  APF
Sbjct  247  GSFQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTI--APF 285

Sequence Alignment: 31. Allergen Name: Tri a gliadin Sequence ID: AAA34285

 Score = 65.3 bits 615,  Expect = 3e-12
 Identities = 138/240 57%, Positives = 169/240 70%, Gaps = 56/240 23%
Query  12   WPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQPQQPFPQQPQQ 71
            W QQQP+P P+Q FSQQP           P   QQQ P PQQP   F Q Q PF QQ  Q
Sbjct  33   W-QQQPLP-PQQSFSQQP-----------PFSQQQQQPLPQQP--SFSQQQPPFSQQ--Q 75
Query  72   PY-PQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQQPPFIQPSL 130
            P   QQP  PF Q QQP  ++PQ Q P   FSQ QQ    PQQ QQ + QQQ P +QPS+
Sbjct  76   PILSQQP--PFSQQQQP--VLPQ-QSP---FSQQQQLVLPPQQQQQQLVQQQIPIVQPSV 127
Query  131  QQQVNPCKNFLLQQCKPVSLVSSLW-SMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHT 189
             QQ+NPCK FL QQC PV++   L  S +W QS C+VM+QQCCQQL QIP+Q +  AI  
Sbjct  128  LQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQSRYEAIRA 187
Query  190  IIHSIIMQ---------QEQQEQQQGMHILLPLYQ-QQQVGQGTLVQGQG---------- 229
            II+SII+Q         Q+QQ QQ G  +     Q QQQ+GQ ++ Q Q           
Sbjct  188  IIYSIILQEQQQGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQ 247
Query  230  --------IIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIG 277
                     +QP+Q A+LEA+ S+ L+TLPTMC+V VP   +    PF  V  G+G
Sbjct  248  QQQVLQGTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFG-VGTGVG 302

Sequence Alignment: 32. Allergen Name: Tri a gliadin Sequence ID: AAA34287

 Score = 62.4 bits 581,  Expect = 2e-11
 Identities = 118/223 52%, Positives = 146/223 65%, Gaps = 20/223 8%
Query  54   PQQQF-LQPQQPFPQQPQQPYPQQPQQPFPQTQQPQQLF-PQSQQPQQQFSQPQQQ-FPQ 110
            PQQ F LQPQQ F  Q QQP+ QQPQQP PQ QQ  Q+  P +        +P    FPQ
Sbjct  1    PQQPFPLQPQQSFLWQSQQPFLQQPQQPSPQPQQVVQIISPATPTTIPSAGKPTSAPFPQ 60
Query  111  PQQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLW-SMIWPQSDCQVMRQ 169
             QQ +Q + QQQ P +QPS+ QQ+NPCK FL QQC PV++   L  S +  QS C+VM+Q
Sbjct  61   QQQQHQQLAQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQ 120
Query  170  QCCQQLAQIPQQLQCAAIHTIIHSIIMQ-----------QEQQEQQQGMHILLPLYQ-QQ 217
            QCCQQL QIPQQ +  AI  II+SII+Q           Q+QQ QQ G  +  P  Q QQ
Sbjct  121  QCCQQLPQIPQQSRYQAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQ 180
Query  218  QVGQGTLVQ--GQG-IIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVA 274
            Q+GQ    Q   QG  +QP+Q AQLE + S+ L+ LPTMC+V VP   +    PF  V  
Sbjct  181  QLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFG-VGT 239
Query  275  GIG 277
            G+G
Sbjct  240  GVG 242

Sequence Alignment: 33. Allergen Name: Tri a 21.0101 Sequence ID: CAY54134

 Score = 62.5 bits 581,  Expect = 2e-11
 Identities = 135/235 57%, Positives = 166/235 70%, Gaps = 55/235 23%
Query  17   PVPQ--PHQPFSQQPQQTFPQ-PQQTFPHQPQQQFPQPQQPQQQFLQPQQPFPQQ----P 69
            PVPQ  P+ P  QQPQ+  P   QQ F  Q QQ+FP  QQP    + PQQP+PQ     P
Sbjct  4    PVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQP----FPPQQPYPQPQPFLP 59
Query  70   QQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQ-QPQQSFPQQQPPFIQP 128
            Q PYPQ PQ PFP    PQQ +PQ   PQ Q+ QPQQ   Q Q Q QQ   QQQ   +Q 
Sbjct  60   QLPYPQ-PQ-PFP----PQQSYPQ---PQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQ 110
Query  129  SLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIH 188
             LQQQ+ PC++ +LQQ   ++  SS  S    Q   Q+++Q CCQQL Q P+Q +C AIH
Sbjct  111  ILQQQLIPCRDVVLQQ-PNIAHASSQVS----QQSYQLLQQLCCQQLWQTPEQSRCQAIH 165
Query  189  TIIHSIIM---------------QQEQQEQQQGMHILLPL----YQQQQ----VGQGTLV 225
             +IH+II+               QQ+QQ+QQQ  +   P     YQQ Q     GQG++ 
Sbjct  166  NVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQ 225
Query  226  ------QGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269
                  Q QG +QPQQ  Q+E IR+L LQTLP MCNVY+PP CS   APF
Sbjct  226  PSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPF 275

Sequence Alignment: 34. Allergen Name: Tri a glutenin Sequence ID: CAA59338

 Score = 61.9 bits 575,  Expect = 2e-11
 Identities = 115/207 55%, Positives = 145/207 70%, Gaps = 36/207 17%
Query  2    MQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQT-FPHQPQQQFPQPQQP--QQQ- 57
            + V  +S +   +   +P   +P+ QQP   +P PQQT FP+Q  Q FPQ Q P  QQQ 
Sbjct  4    IAVVATSTIAQMETSCIPGLERPWQQQP---LP-PQQTLFPQQ--QPFPQQQPPFSQQQP 57
Query  58   -FLQPQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQ 116
             F Q Q PF QQ     P  P+ PF   QQP  ++PQ Q P   FSQ Q  +P PQQ QQ
Sbjct  58   SFSQQQPPFSQQQ----PILPEPPFSLQQQP--VLPQ-QSP---FSQQQLVLP-PQQ-QQ 105
Query  117  SFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLW-SMIWPQSDCQVMRQQCCQQL 175
             +PQQQ   +QPS+ QQ+NPCK FL QQC PV++   L  S +W QS C+VM+QQCCQQL
Sbjct  106  QLPQQQISIVQPSVLQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSRCHVMQQQCCQQL 165
Query  176  AQIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQPQQ 235
            +QIP+Q +  AI  I +SII+Q    EQQQG    +   QQQQ  Q     GQG+ Q QQ
Sbjct  166  SQIPEQSRYDAICAITYSIILQ----EQQQG----FVQAQQQQPQQS----GQGVSQSQQ 213
Query  236  PAQ 238
             +Q
Sbjct  214  QSQ 216

Sequence Alignment: 35. Allergen Name: Tri a gliadin Sequence ID: AAA34286

 Score = 62.4 bits 579,  Expect = 2e-11
 Identities = 120/264 45%, Positives = 160/264 60%, Gaps = 36/264 13%
Query  7    SSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQPQQPFP 66
            S+  Q+ +    P  + P++         P     + P   F    +P  +   P+    
Sbjct  29   SNNNQFYRNNNSPGHNNPLNNNNSPNNNSPSNHHNNSPNNNFQYHTHPSNHKNLPHTNNI 88
Query  67   QQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQQPPFI 126
            QQ Q P+ QQ Q PF Q QQP  ++PQ Q P   FSQ QQ    PQQ QQ + QQQ P +
Sbjct  89   QQQQPPFSQQQQPPFSQQQQP--VLPQ-QSP---FSQQQQLVLPPQQQQQQLVQQQIPIV 142
Query  127  QPSLQQQVNPCKNFLLQQCKPVSLVSSLW-SMIWPQSDCQVMRQQCCQQLAQIPQQLQCA 185
            QPS+ QQ+NPCK FL QQC PV++   L  S +W QS C+VM+QQCCQQL QIP+Q +  
Sbjct  143  QPSVLQQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQSRYE 202
Query  186  AIHTIIHSIIMQ---------QEQQEQQQGMHILLPLYQ-QQQVGQGTLVQGQG------ 229
            AI  II+SII+Q         Q+QQ QQ G  +     Q QQQ+GQ ++ Q Q       
Sbjct  203  AIRAIIYSIILQEQQQGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQP 262
Query  230  ------------IIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIG 277
                         +QP+Q A+LEA+ S+ L+TLPTMC+V VP   +    PF  V  G+G
Sbjct  263  QQQQQQQVLQGTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFG-VGTGVG 321

Sequence Alignment: 36. Allergen Name: Tri a glutenin Sequence ID: CAA36063

 Score = 61.5 bits 569,  Expect = 4e-11
 Identities = 131/256 51%, Positives = 170/256 66%, Gaps = 47/256 18%
Query  2    MQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQT-FPHQPQQQFPQPQQPQQQFLQ 60
            + V  +S +   +   +P   +P+ +QP   +P PQ+T FP+Q  Q FPQ QQP   F Q
Sbjct  10   LAVVATSTIAQMETSCIPGLERPWQEQP---LP-PQHTLFPQQ--QPFPQQQQP--PFSQ 61
Query  61   PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ 120
             Q  F QQ  QP    PQ PF Q QQP  ++PQ Q P   FSQ Q  +P PQQ  Q   Q
Sbjct  62   QQPSFLQQ--QPI--LPQLPFSQQQQP--VLPQ-QSP---FSQQQLVLP-PQQQYQQVLQ 110
Query  121  QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLW-SMIWPQSDCQVMRQQCCQQLAQIP 179
            QQ P +QPS+ QQ+NPCK FL QQC PV++   L  S +  QS C+VM+QQCCQQL QIP
Sbjct  111  QQIPIVQPSVLQQLNPCKVFLQQQCNPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIP 170
Query  180  QQLQCAAIHTIIHSIIMQ---------QEQQEQQQGMHILLPLYQ-QQQVGQGTLVQGQG 229
            +Q +   I  I +SII+Q         Q+QQ QQ G  +     Q QQQ+GQ ++ Q Q 
Sbjct  171  EQSRYDVIRAITYSIILQEQQQGFVQAQQQQPQQLGQGVSQSQQQSQQQLGQCSFQQPQQ 230
Query  230  ---------------IIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVA 274
                            +QP+Q A+LE + S+ L+TLPTMC+V VP   S    PFS V  
Sbjct  231  QLGQQPQQQQVLQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPLYSSTTSVPFS-VGT 289
Query  275  GIG 277
            G+G
Sbjct  290  GVG 292

Sequence Alignment: 37. Allergen Name: Tri a gliadin Sequence ID: AAA34284

 Score = 56.8 bits 515,  Expect = 7e-10
 Identities = 93/169 55%, Positives = 122/169 72%, Gaps = 25/169 14%
Query  86   QPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQC 145
            QPQ   PQ  QPQQ  SQ QQQ  Q QQ QQ   QQ+   +Q  LQQQ+ PC + +LQQ 
Sbjct  2    QPQ---PQYSQPQQPISQQQQQ--QQQQQQQQ--QQEQQILQQILQQQLIPCMDVVLQQH 54
Query  146  KPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQ 205
                 ++   S +  QS  Q++++ CCQ+L QIP+Q QC AIH ++H+II++Q+QQ+QQQ
Sbjct  55   N----IAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQQKQQQ 110
Query  206  G----MHILLPLYQQQQVGQGTLV------QGQGIIQPQQPAQLEAIRSLVLQTLPTMCN 255
                      PL QQ  +GQG++       Q QG +QPQQ  Q+E IR+L LQTLP MCN
Sbjct  111  QPSSQFSFQQPL-QQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFE-IRNLALQTLPAMCN 168
Query  256  VYVPPECSIIKAPF 269
            VY+PP C+I  APF
Sbjct  169  VYIPPYCTI--APF 180

Sequence Alignment: 38. Allergen Name: Tri a glutenin Sequence ID: AAB02788

 Score = 37.9 bits 280,  Expect = 0.001
 Identities = 90/216 41%, Positives = 107/216 49%, Gaps = 32/216 14%
Query  6    PSSQVQWPQQQPVPQPHQ-PFSQQPQQTFP--QPQQTFPHQPQQQFPQPQQPQQQFLQP- 61
            P+S  Q  Q Q   Q +Q    QQ QQ+    Q QQ+   Q  QQ  Q QQP Q+  QP 
Sbjct  317  PTSAQQPGQLQQSTQEQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQR--QPG 374
Query  62   -QQPFPQQ--PQQP--YPQQPQQPFPQTQQPQQLF-P----QSQQPQQ-QFSQPQQQFPQ 110
                 PQQ    QP  YP  PQQP  Q QQP+QL  P    Q QQP+Q Q  Q Q+Q  Q
Sbjct  375  YYSTSPQQLGQGQPRYYPTSPQQP-GQEQQPRQLQQPEQGQQGQQPEQGQQGQQQRQGEQ 433
Query  111  PQQPQQSFPQQQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQ 170
             QQP Q    QQP   QP      +P ++    Q +P    +S       Q   Q  +  
Sbjct  434  GQQPGQGQQGQQPGQGQPGYYP-TSPQQS---GQGQPGYYPTSPQQSGQLQQPAQGQQPG 489
Query  171  CCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGI 230
              QQ  Q  Q  Q    +   +    QQ  QEQQ        L Q QQ GQG    G+  
Sbjct  490  QEQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQ--------LEQWQQSGQGQ--PGHYP 539
Query  231  IQPQQPAQ 238
              P QP Q
Sbjct  540  TSPLQPGQ 547

Sequence Alignment: 39. Allergen Name: Tri a glutenin Sequence ID: CAA43331

 Score = 37.2 bits 272,  Expect = 0.002
 Identities = 96/231 41%, Positives = 111/231 48%, Gaps = 36/231 15%
Query  3    QVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQP--QQQFLQ 60
            Q   S Q Q  QQ    Q +QP  +QP      PQQ    QP+     PQQP  +QQ  Q
Sbjct  355  QGQQSGQRQQDQQSG--QGQQPGQRQPGYYSTSPQQLGQGQPRYYPTSPQQPGQEQQPRQ 412
Query  61   PQQPFP-QQPQQPYP-QQPQQPFP--QTQQPQQLFPQSQQPQQ-----QFSQPQQQF--- 108
             QQP   QQ QQP   QQ QQP    Q QQP Q   Q QQP Q       + PQQ     
Sbjct  413  LQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQG-QQGQQPGQGQPGYYPTSPQQSGQGQ 471
Query  109  P--QPQQPQQSFPQQQPPF-IQPSLQQQ-VNPCKNFLLQQCKPVSLVSSLWSMIWPQSDC 164
            P   P  PQQS   QQP    QP  +QQ   P +    QQ              +P S  
Sbjct  472  PGYYPTSPQQSGQLQQPAQGQQPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQ 531
Query  165  QVMRQQCCQQLAQIPQ---------QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQ 215
            Q  ++Q  +Q  Q  Q          LQ    +   +    QQ  Q QQ G ++  P   
Sbjct  532  QSGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPG-QLQQPTQG 590
Query  216  QQ--QVGQGTLVQ--GQGIIQPQQPAQ 238
            QQ  Q GQG   Q  GQG  Q QQP Q
Sbjct  591  QQGQQPGQGQQGQQPGQGQ-QGQQPGQ 616

Sequence Alignment: 40. Allergen Name: Tri a glutenin Sequence ID: CAA31396

 Score = 35.7 bits 255,  Expect = 0.005
 Identities = 94/217 43%, Positives = 117/217 53%, Gaps = 42/217 19%
Query  6    PSS-QVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQ--QFPQPQQPQQQFLQPQ 62
            P+S Q    +QQPV Q +QP  +Q QQ     Q  +P  PQQ  Q  QP+Q QQ     Q
Sbjct  206  PTSLQHTGQRQQPV-QGQQP--EQGQQPGQWQQGYYPTSPQQLGQGQQPRQWQQSGQGQQ 262
Query  63   QPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQP--QQQFSQPQQ-QFP----QPQQPQ 115
              +P   QQP   Q  + +   QQP Q   Q + P  QQQ  Q QQ ++P    QP Q Q
Sbjct  263  GHYPTSLQQPGQGQQGHYLASQQQPGQG-QQGHYPASQQQPGQGQQGHYPASQQQPGQGQ 321
Query  116  QS-FP--QQQPPFIQ----PSLQQQVNPCKNFLLQQCKPVSLVSSLWSMI--WPQSDCQV 166
            Q  +P  QQ+P   Q    P+ QQQ  P +    Q   P SL          +P S  Q 
Sbjct  322  QGHYPASQQEPGQGQQGQIPASQQQ--PGQG--QQGHYPASLQQPGQGQQGHYPTS-LQQ 376
Query  167  MRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQ--QGMHILLPLYQQQQVGQGTL 224
            + Q   QQ  Q  Q+ Q    +   +    QQ +QEQQ  QG +   P    QQ GQG  
Sbjct  377  LGQG--QQTGQPGQKQQPGQGQQTGQG---QQPEQEQQPGQGQQGYYPT-SLQQPGQGQQ 430
Query  225  VQGQGI--IQP---QQPAQ 238
             QGQG     P   QQP Q
Sbjct  431  -QGQGQQGYYPTSLQQPGQ 448

Sequence Alignment: 41. Allergen Name: Tri a glutenin Sequence ID: CAA31395

 Score = 36.0 bits 257,  Expect = 0.006
 Identities = 92/227 40%, Positives = 107/227 47%, Gaps = 26/227 11%
Query  3    QVDPSSQVQWPQQQPVPQPHQP--FSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQ--QF 58
            QV    Q Q P Q   P   QP  +   PQQ+  Q Q  +     QQ  Q QQP Q  Q 
Sbjct  398  QVGQGQQAQQPGQGQQPGQGQPGYYPTSPQQS-GQGQPGYYLTSPQQSGQGQQPGQLQQS 456
Query  59   LQPQQ-PFPQQPQQP-YPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQ--QFPQP--- 111
             Q Q+   P Q QQP   QQ QQP  Q QQ QQ  P   QP    + PQQ  Q  QP   
Sbjct  457  AQGQKGQQPGQGQQPGQGQQGQQP-GQGQQGQQ--PGQGQPGYYPTSPQQSGQGQQPGQW 513
Query  112  QQPQQSFPQQQPPF-IQPSLQQQ-VNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQ 169
            QQP Q  P   P   +QP   Q   +P      QQ         L      Q   Q+ + 
Sbjct  514  QQPGQGQPGYYPTSPLQPGQGQPGYDPTSP---QQPGQGQQPGQLQQPAQGQQGQQLAQG 570
Query  170  QCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQ--QVGQGTLVQ- 226
            Q  QQ AQ+ QQ Q  A     + +   Q+ Q+  QG +   P   QQ  Q GQG   Q 
Sbjct  571  QQGQQPAQV-QQGQQPAQGQQGQQLGQGQQGQQPGQGQQGQQPAQGQQGQQPGQGQHGQQ 629
Query  227  -GQGIIQPQQPAQ 238
             GQG  Q QQP Q
Sbjct  630  PGQGQ-QGQQPGQ 641

Sequence Alignment: 42. Allergen Name: Tri a 26.0101 Sequence ID: P10388

 Score = 36.0 bits 257,  Expect = 0.006
 Identities = 92/227 40%, Positives = 107/227 47%, Gaps = 26/227 11%
Query  3    QVDPSSQVQWPQQQPVPQPHQP--FSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQ--QF 58
            QV    Q Q P Q   P   QP  +   PQQ+  Q Q  +     QQ  Q QQP Q  Q 
Sbjct  398  QVGQGQQAQQPGQGQQPGQGQPGYYPTSPQQS-GQGQPGYYLTSPQQSGQGQQPGQLQQS 456
Query  59   LQPQQ-PFPQQPQQP-YPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQ--QFPQP--- 111
             Q Q+   P Q QQP   QQ QQP  Q QQ QQ  P   QP    + PQQ  Q  QP   
Sbjct  457  AQGQKGQQPGQGQQPGQGQQGQQP-GQGQQGQQ--PGQGQPGYYPTSPQQSGQGQQPGQW 513
Query  112  QQPQQSFPQQQPPF-IQPSLQQQ-VNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQ 169
            QQP Q  P   P   +QP   Q   +P      QQ         L      Q   Q+ + 
Sbjct  514  QQPGQGQPGYYPTSPLQPGQGQPGYDPTSP---QQPGQGQQPGQLQQPAQGQQGQQLAQG 570
Query  170  QCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQ--QVGQGTLVQ- 226
            Q  QQ AQ+ QQ Q  A     + +   Q+ Q+  QG +   P   QQ  Q GQG   Q 
Sbjct  571  QQGQQPAQV-QQGQQPAQGQQGQQLGQGQQGQQPGQGQQGQQPAQGQQGQQPGQGQHGQQ 629
Query  227  -GQGIIQPQQPAQ 238
             GQG  Q QQP Q
Sbjct  630  PGQGQ-QGQQPGQ 641

Sequence Alignment: 43. Allergen Name: Tri a glutenin Sequence ID: CAA43361

 Score = 35.1 bits 247,  Expect = 0.009
 Identities = 102/224 45%, Positives = 123/224 54%, Gaps = 56/224 25%
Query  6    PSSQVQWPQQQPVPQPHQ---PFS-QQPQQ--TFPQPQQTF-PHQPQQ--QFPQPQQPQQ 56
            PSS  Q  Q Q + Q +Q   P S QQP Q     Q QQ + P  PQ+  Q  QP Q QQ
Sbjct  185  PSSLQQPGQGQQIGQGQQGYYPTSLQQPGQGQQIGQGQQGYYPTSPQHPGQRQQPGQGQQ 244
Query  57   -----------QFLQPQQPFPQQPQQPYPQQPQQPFPQTQQP--QQLFPQSQQ---P--Q 98
                       Q  Q QQ   Q  Q  YP  PQQ + Q QQP   Q   Q QQ   P  Q
Sbjct  245  IGQGQQLGQGRQIGQGQQS-GQGQQGYYPTSPQQ-LGQGQQPGQWQQSGQGQQGYYPTSQ 302
Query  99   QQFSQPQQ-QFP----QPQQPQQS-FP--QQQPPFIQ----PSLQQQVNPCK--NFLLQQ 144
            QQ  Q QQ Q+P    QP Q QQ  +P  QQQP   Q    P+ QQQ    +  ++L  Q
Sbjct  303  QQPGQGQQGQYPASQQQPGQGQQGQYPASQQQPGQGQQGQYPASQQQPGQGQQGHYLASQ 362
Query  145  CKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHTIIHSIIMQQEQQEQQ 204
             +P           +P S  Q  + Q  +  A + Q  Q    H   +   +QQ  Q QQ
Sbjct  363  QQP----GQGQQRHYPASLQQPGQGQQGHYTASLQQPGQGQQGH---YPASLQQVGQGQQ 415
Query  205  QGMHILLPLYQQQQVGQGTLV-QGQGIIQPQQPAQLEAIR 243
             G      L Q+QQ GQG    QGQ + Q QQP Q +  R
Sbjct  416  IGQ-----LGQRQQPGQGQQTRQGQQLEQGQQPGQGQQTR 450

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.