The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

NSARGFDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATE
KLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAI
TEVDLERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQR
LKDAENRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAK96889 Cra g 1 233 1401 326.1 6.1e-91
AVD53650 Sac g 1.0101 284 1285 299.6 7.1e-83
APG42675 Hal l 1.0101 284 1149 268.6 1.5e-73
AAG08987 Hal d 1 284 1132 264.7 2.2e-72
CAB38044 Hel as 1 284 1126 263.3 5.8e-72
AAG08988 Per v 1 284 1071 250.8 3.4e-68
AAG08989 Mim n 1 284 1039 243.5 5.4e-66
O44119 Hom a 1.0101 284 944 221.8 1.8e-59
O61379 Pan s 1 274 941 221.2 2.7e-59
AEX31649 Cho a 10.0101 284 941 221.2 2.9e-59
C0LU07 Pro c 1.0101 284 941 221.2 2.9e-59
AAC48288 Hom a 1.0102 284 941 221.2 2.9e-59
D3XNR9 Mac r 1.0101 284 940 220.9 3.4e-59
CBY17558 Pan b 1.0101 284 940 220.9 3.4e-59
A7L5V2 Scy p 1.0101 284 939 220.7 3.9e-59
M1H607 Por p 1.0101 284 935 219.8 7.4e-59
M4M2H6 Mel l 1.0101 284 933 219.3 1e-58
BAA04557 Der f 10.0101 299 933 219.3 1.1e-58
Q25456 Met e 1 274 932 219.1 1.1e-58
ABU97466 Blo t 10.0101 284 931 218.9 1.4e-58
EU410072 Lit v 1.0101 284 931 218.9 1.4e-58
AAX37288 Pen m 1 284 931 218.9 1.4e-58
11893851 Pen a 1 284 931 218.9 1.4e-58
AAT40866 Tyr p 10.0101 284 930 218.7 1.6e-58
ACN32322 Asc l 3.0101 287 923 217.1 5e-58
Q9NFZ4 Lep d 10 284 920 216.4 7.9e-58
NP_001103782 Bomb m 3.0101 285 915 215.2 1.7e-57
O18416 Der p 10 284 912 214.5 2.8e-57
Q9NAS5 Ani s 3 284 908 213.6 5.3e-57
Q9UB83 Per a 7 284 907 213.4 6.2e-57
Q17H75 Aed a 10.0101 285 900 211.8 1.9e-56
AAD19606 Per a 7.0102 284 898 211.4 2.6e-56
AAF72534 Bla g 7.0101 284 893 210.2 5.6e-56
CAA09938 Chi k 10 285 876 206.3 8.3e-55
Q9N2R3 Cha f 1 264 823 194.3 3.3e-51
CAC84590 Lep s 1 284 797 188.3 2.2e-49
NP_001117128 Sal s 4.0101 284 786 185.8 1.2e-48
XP_026775428 Pan h 4.0201 284 766 181.3 2.9e-47
AGM32377.1 Copt f 7.0101 256 753 178.3 2e-46
Q17H80 Aed a 10.0201 284 745 176.5 8e-46
XP_026781482 Pan h 4.0101 284 712 169.0 1.5e-43
QPB41107 Rap v 2.0101 859 203 52.8 4.3e-08
AAO73464 Der p 11 875 195 50.9 1.5e-07
AAK39511 Der f 11.0101 692 189 49.6 3.1e-07
AAM83103 Blo t 11 875 171 45.5 6.8e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 326.1 bits 1401,  Expect = 6e-91
 Identities = 233/233 100%, Positives = 233/233 100%, Gaps = 0/233 0%
Query  1    NSARGFDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATE 60
            NSARGFDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATE
Sbjct  1    NSARGFDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATE 60
Query  61   KLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAI 120
            KLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAI
Sbjct  61   KLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAI 120
Query  121  TEVDLERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQR 180
            TEVDLERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQR
Sbjct  121  TEVDLERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQR 180
Query  181  LKDAENRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
            LKDAENRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY
Sbjct  181  LKDAENRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233

Sequence Alignment: 2. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 299.6 bits 1285,  Expect = 7e-83
 Identities = 210/228 92%, Positives = 220/228 96%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            FD VNEKYQ+CQ K EEAEK ASE+EQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA
Sbjct  57   FDIVNEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL
Sbjct  117  SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAEARLEAAEAKV++LEE+L VVGNN+K+L++   +ASQREDSYEETIRDLTQRLKDAE
Sbjct  177  ERAEARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQASQREDSYEETIRDLTQRLKDAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
            NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY
Sbjct  237  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 284

Sequence Alignment: 3. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 268.6 bits 1149,  Expect = 2e-73
 Identities = 190/233 81%, Positives = 207/233 88%, Gaps = 0/233 0%
Query  1    NSARGFDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATE 60
            N    FD VNE+ QE  TK+E +EK  +E EQE+    R+I LLEED+ER+EERLQTATE
Sbjct  52   NLENDFDNVNEQLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATE 111
Query  61   KLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAI 120
            +LEEASKAADESER RKVLE+ + A +ER D LE QL EAK IAE+A++KYDEAARKLAI
Sbjct  112  RLEEASKAADESERGRKVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAI 171
Query  121  TEVDLERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQR 180
            TEVDLERAEARLEAAEAK+LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQR
Sbjct  172  TEVDLERAEARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQR 231
Query  181  LKDAENRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
            LKDAENRATEAERTVSKLQKEVDRLEDELLAEKE+YKAISDELDQTFAELAGY
Sbjct  232  LKDAENRATEAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 4. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 264.7 bits 1132,  Expect = 2e-72
 Identities = 187/233 80%, Positives = 205/233 87%, Gaps = 0/233 0%
Query  1    NSARGFDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATE 60
            N    FD VNE+ QE   K+E +EK  +E EQE+    R+I LLEED+ER+EERLQTATE
Sbjct  52   NLENDFDNVNEQLQEAMAKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATE 111
Query  61   KLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAI 120
            +LEEASKAADESER  +VLE+ + A +ER D LE QL EAK IAE+A++KYDEAARKLAI
Sbjct  112  RLEEASKAADESERGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAI 171
Query  121  TEVDLERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQR 180
            TEVDLERAEARLEAAEAK+LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQR
Sbjct  172  TEVDLERAEARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQR 231
Query  181  LKDAENRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
            LKDAENRATEAERTVSKLQKEVDRLEDELLAEKE+YKAISDELDQTFAELAGY
Sbjct  232  LKDAENRATEAERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTFAELAGY 284

Sequence Alignment: 5. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 263.3 bits 1126,  Expect = 6e-72
 Identities = 186/228 81%, Positives = 204/228 89%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            FD++NE+  +  TK+E +EK  +E E E   L RRIQLLEED+ERSEERLQ+ATEKLEEA
Sbjct  57   FDSINEQLLDANTKLEASEKKNAEIESETAGLQRRIQLLEEDLERSEERLQSATEKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            SKAADESER RKVLE+ + A +ER D LE QL EAK IAE+A++K+DEAARKLAITEVDL
Sbjct  117  SKAADESERGRKVLESRSLADDERLDGLEAQLKEAKYIAEDAERKFDEAARKLAITEVDL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAEARLEAAEAK+LELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE
Sbjct  177  ERAEARLEAAEAKILELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
            NRA+EAERTVSKLQKEVDRLEDELLAEKERYKA SDELD TFAELAGY
Sbjct  237  NRASEAERTVSKLQKEVDRLEDELLAEKERYKATSDELDSTFAELAGY 284

Sequence Alignment: 6. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 250.8 bits 1071,  Expect = 3e-68
 Identities = 176/228 77%, Positives = 198/228 86%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D  N + Q+ Q K E AEK   E EQEIQSL R+I LLEE + ++EER+ TA+ KLEEA
Sbjct  57   YDNCNTQLQDVQAKYERAEKQIQEHEQEIQSLTRKISLLEEGIMKAEERFTTASGKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            SKAADESERNRKVLENLN+ ++ER D LEKQLTEAK IAEEADKKY+EAARKLAITEVDL
Sbjct  117  SKAADESERNRKVLENLNSGNDERIDQLEKQLTEAKWIAEEADKKYEEAARKLAITEVDL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAEARLEAAEAKV++LEE+L VVG N+K+L++   +ASQREDSYEETIRDLT RLKDAE
Sbjct  177  ERAEARLEAAEAKVIDLEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
            NRATEAERTVSKLQKEVDRLEDELL EKE+YKAISDELD TFAELAGY
Sbjct  237  NRATEAERTVSKLQKEVDRLEDELLTEKEKYKAISDELDATFAELAGY 284

Sequence Alignment: 7. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 243.5 bits 1039,  Expect = 5e-66
 Identities = 169/228 74%, Positives = 194/228 85%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +DTVNE+ QE  TK+E +EK  ++ E ++  L RR+ LLEED ERSEE+L + TEKLEEA
Sbjct  57   YDTVNEQLQEANTKLENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            SKAADESERNRKVLE  +N+ EER D LEKQL  AK +A +AD K+DEAARKLAITEVDL
Sbjct  117  SKAADESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE RLEAA+AKVLELEEEL VVG N+K+L++   +ASQREDSYEETIRDLT+ LKDAE
Sbjct  177  ERAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
            NRATEAER V KLQKEVDRLEDELLAEKERYKAISD+LDQTFAE+AGY
Sbjct  237  NRATEAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEIAGY 284

Sequence Alignment: 8. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 221.8 bits 944,  Expect = 2e-59
 Identities = 151/228 66%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E+     TK+EE EK    AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQVQEQLSLANTKLEEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 9. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 221.2 bits 941,  Expect = 3e-59
 Identities = 151/228 66%, Positives = 187/228 82%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +  T++EE +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  47   LDQVQESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 106
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  107  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 166
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K +ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  167  ERAEERAETGESKFVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 226
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  227  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 10. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 221.2 bits 941,  Expect = 3e-59
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E + +  TK+EE EK    AE ++ +LNRRIQL+EED+ERSEERL+ AT KLEEA
Sbjct  57   LDQVQESFTQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S AADESER RK+LE+ +   EER D LE QL EA+++AE+AD+KYDE ARKLA+ E DL
Sbjct  117  SHAADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+ISDELDQTFAEL GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 11. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 221.2 bits 941,  Expect = 3e-59
 Identities = 150/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +  T++EE +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQVQESLLKANTQLEEKDKAISNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELTGY 284

Sequence Alignment: 12. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 221.2 bits 941,  Expect = 3e-59
 Identities = 150/228 65%, Positives = 187/228 82%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +  T++EE +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQVQESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 13. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 220.9 bits 940,  Expect = 3e-59
 Identities = 150/228 65%, Positives = 187/228 82%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D+V E   +    +EE +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDSVQEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 14. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 220.9 bits 940,  Expect = 3e-59
 Identities = 150/228 65%, Positives = 187/228 82%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D+V E   +    +EE +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDSVQEALLKANQHLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 15. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 220.7 bits 939,  Expect = 4e-59
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D   E+     TK++E EK    AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQAQEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E+ E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE
Sbjct  177  ERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 16. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 219.8 bits 935,  Expect = 7e-59
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +  T++EE +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQVQESLLKANTQLEEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+ +DELDQ F+EL+GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSTTDELDQAFSELSGY 284

Sequence Alignment: 17. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 219.3 bits 933,  Expect = 1e-58
 Identities = 151/228 66%, Positives = 184/228 80%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            FD V E      T   E +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   FDQVQEALLLANTNAVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 18. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 219.3 bits 933,  Expect = 1e-58
 Identities = 148/228 64%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E+     TK+EE EK    AE ++ +LNRRIQL+EED+ERSEERL+ AT KLEEA
Sbjct  72   LDQVQEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEA 131
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S++ADESER RK+LE+ +   EER D LE QL EA+++AE+AD+KYDE ARKLA+ E DL
Sbjct  132  SQSADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADL 191
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE
Sbjct  192  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAE 251
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+ISDELDQTFAEL GY
Sbjct  252  ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 299

Sequence Alignment: 19. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 219.1 bits 932,  Expect = 1e-58
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +   ++ E +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  47   LDQVQESLLKANNQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 106
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  107  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 166
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  167  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 226
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  227  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 274

Sequence Alignment: 20. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 218.9 bits 931,  Expect = 1e-58
 Identities = 148/228 64%, Positives = 185/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +  TK+EE EK+   AE ++ +LNRRIQL+EED+ERSEERL+ AT KLEEA
Sbjct  57   LDQVQESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S +ADESER RK+LE+ +   EER D LE QL EA+++AE+AD+KYDE ARKLA+ E DL
Sbjct  117  SHSADESERMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E K++ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE
Sbjct  177  ERAEERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+ISDELDQTFAEL GY
Sbjct  237  ARAEFAERSVRKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 21. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 218.9 bits 931,  Expect = 1e-58
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +   ++ E +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQVQESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 22. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 218.9 bits 931,  Expect = 1e-58
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +   ++ E +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQVQESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 23. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 218.9 bits 931,  Expect = 1e-58
 Identities = 149/228 65%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +   ++ E +K  S AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQVQESLLKANIQLVEKDKALSNAEGEVAALNRRIQLLEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ LT +LK AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+I+DELDQTF+EL+GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELSGY 284

Sequence Alignment: 24. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 218.7 bits 930,  Expect = 2e-58
 Identities = 148/228 64%, Positives = 185/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +  TK+EE EK    AE ++ +LNRRIQL+EED+ERSEERL+ AT KLEEA
Sbjct  57   LDQVQENLTQATTKLEEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S +ADESER RK+LE+ +   EER D LE QL EA+L+AE+AD+KYDE ARKLA+ E DL
Sbjct  117  SHSADESERMRKMLEHRSITDEERMDGLESQLKEARLMAEDADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTSKLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+Y++ISDELDQTFAEL GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVHEKEKYESISDELDQTFAELTGY 284

Sequence Alignment: 25. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 217.1 bits 923,  Expect = 5e-58
 Identities = 147/228 64%, Positives = 182/228 79%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D   E      + +EE EK   EAE E+ +LNRR+ LLEE++ER+EERL+ ATEKLEEA
Sbjct  57   LDKAQEDLSVANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATEKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            +  ADESER RKV+EN +   EER + +E QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  THTADESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R EA E K++ELEEEL+VVGNN+KSLE+SE++A QREDSYEE IR ++ RLK+AE
Sbjct  177  ERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKERYK+IS+ELDQTF EL+GY
Sbjct  237  TRAEFAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 26. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 216.4 bits 920,  Expect = 8e-58
 Identities = 146/228 64%, Positives = 186/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E   +  TK+EE EK+   AE ++ +LNRRIQL+EED+ERSE RL+ AT KLEEA
Sbjct  57   LDQVQESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S++ADESER RK+LE+ +   EER + LE QL EA+++AE+AD+KYDE ARKLA+ E DL
Sbjct  117  SQSADESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A QRE++YE+ IR +T +LK+AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK+ISDELDQTFAEL GY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 27. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 215.2 bits 915,  Expect = 2e-57
 Identities = 148/225 65%, Positives = 178/225 79%, Gaps = 0/225 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D   E   +   K+EE EK    AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQTQESLMQVNGKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLSEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + A EER D LE QL EA+++AEEADKKYDE ARKLA+ E DL
Sbjct  117  SQAADESERARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E+ E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE+ Y+  I+ LT RLK+AE
Sbjct  177  ERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAEL 230
             RA  AER+V KLQKEVDRLEDEL+AEKE+YK I D+LD  F EL
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVAEKEKYKDIGDDLDTAFVEL 281

Sequence Alignment: 28. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 214.5 bits 912,  Expect = 3e-57
 Identities = 145/228 63%, Positives = 185/228 81%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D V E+     TK+EE EK    AE ++ +LNRRIQL+EED+ERSEERL+ AT KLEEA
Sbjct  57   LDQVQEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S++ADESER RK+LE+ +   EER + LE QL EA+++AE+AD+KYDE ARKLA+ E DL
Sbjct  117  SQSADESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A QRE+++E+ IR +T +LK+AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEV RLEDEL+ EKE+YK+ISDELDQTFAEL GY
Sbjct  237  ARAEFAERSVQKLQKEVGRLEDELVHEKEKYKSISDELDQTFAELTGY 284

Sequence Alignment: 29. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 213.6 bits 908,  Expect = 5e-57
 Identities = 144/228 63%, Positives = 179/228 78%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D   E      + +EE EK   EAE E+ +LNRR+ LLEE++ER+EERL+ AT KLEEA
Sbjct  57   LDKAQEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATAKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            +  ADESER RKV+EN +   EER + +E QL EA+++AEEAD+KYDE ARKL + E DL
Sbjct  117  THTADESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLTMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E K++ELEEEL+VVGNN+KSLE+SE++A QREDSYEE IR ++ RLK+AE
Sbjct  177  ERAEERAETGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSARLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKERYK+IS+ELDQTF EL+GY
Sbjct  237  TRAEFAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQELSGY 284

Sequence Alignment: 30. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 213.4 bits 907,  Expect = 6e-57
 Identities = 145/228 63%, Positives = 180/228 78%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D   E+  +   K++E +K    AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+A DESER RK+LE+   A EER D LE QL EA+++AEEADKKYDE ARKLA+ E DL
Sbjct  117  SQAVDESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E+ E+K++ELEEEL+VVGNN+KSLE+SE++A+ RE+ Y++ I+ LT RLK+AE
Sbjct  177  ERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK I D+LD TF ELAGY
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELAGY 284

Sequence Alignment: 31. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 211.8 bits 900,  Expect = 2e-56
 Identities = 146/225 64%, Positives = 173/225 76%, Gaps = 0/225 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D   E       K+EE EK    AE E+ +LNRRIQLLEED+ERSEERL +AT KL EA
Sbjct  57   LDQTQEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEERLASATAKLSEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S AADESER RKVLEN   A EER D LE QL EA+++AEEADKKYDE ARKLA+ E DL
Sbjct  117  SAAADESERARKVLENRALADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R EA E K++ELEEEL+VVGNN+KSLE+SE++A+QRE+ Y+  I+ LT RLK+AE
Sbjct  177  ERAEERAEAGEGKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAEL 230
             RA  AER+V KLQKEVDRLEDEL+ EKE+Y+ I D+LD  F EL
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVMEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 32. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 211.4 bits 898,  Expect = 3e-56
 Identities = 144/227 63%, Positives = 179/227 78%, Gaps = 0/227 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D   E+  +   K++E +K    AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RK+LE+   A EER D LE QL EA+++AEEADKKYDE ARKLA+ E DL
Sbjct  117  SQAADESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E+ E+K++ELEEEL+VVGNN+KSLE+SE++A+ RE+ Y++ I+ LT RLK+AE
Sbjct  177  ERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAG 232
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK I D+LD TF EL G
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTELIG 283

Sequence Alignment: 33. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 210.2 bits 893,  Expect = 6e-56
 Identities = 143/227 62%, Positives = 177/227 77%, Gaps = 0/227 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D   E+  +   K++E +K    AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RK+LE+   A EER D LE QL EA+++AEEADKKYDE ARKLA+ E DL
Sbjct  117  SQAADESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E  E+K++ELEEEL+VVGNN+KSLE+SE++A+ RE+ Y++ I+ L  RLK+AE
Sbjct  177  ERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAG 232
             RA  AER+V KLQKEVDRLEDEL+ EKE+YK I D+LD TF EL G
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVHEKEKYKYICDDLDMTFTELIG 283

Sequence Alignment: 34. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 206.3 bits 876,  Expect = 8e-55
 Identities = 141/212 66%, Positives = 171/212 80%, Gaps = 0/212 0%
Query  19   KMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAADESERNRKV 78
            K+E  EK    AE E+ +LNRRIQLL ED++RSEERL +AT KL EAS AADESER RK+
Sbjct  70   KLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAADESERARKI 129
Query  79   LENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAEARLEAAEAK 138
            LEN + A EER D LE QL EA+++AEEADKKYDE ARKLA+ E DLERAE R EA EAK
Sbjct  130  LENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEAGEAK 189
Query  139  VLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAERTVSKL 198
            ++ELEEEL+VVGNN+KSLE+SE++A+QRE+ Y+  I+ LT RLK+AE RA  AER+V KL
Sbjct  190  IVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERSVQKL 249
Query  199  QKEVDRLEDELLAEKERYKAISDELDQTFAEL 230
            QKEVDRLEDEL++EKE+Y+ I D+LD  F EL
Sbjct  250  QKEVDRLEDELVSEKEKYREIGDDLDTAFVEL 281

Sequence Alignment: 35. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 194.3 bits 823,  Expect = 3e-51
 Identities = 133/208 63%, Positives = 165/208 79%, Gaps = 0/208 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D   E+     TK++E EK    AE E+ +LNRRIQL EED+ERSEERL TAT KL EA
Sbjct  57   LDQAQEQLSAANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RKVLEN + + EER D LE QL EA+++AEEAD+KYDE ARKLA+ E DL
Sbjct  117  SQAADESERMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E+ E+K++ELEEEL+VVGNN+KSLE+SE++A+QRE++Y+E I+ L  +LK AE
Sbjct  177  ERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEK 213
             RA  AER+V KLQKEVDRLEDEL+ EK
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDELVNEK 264

Sequence Alignment: 36. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 188.3 bits 797,  Expect = 2e-49
 Identities = 128/228 56%, Positives = 171/228 75%, Gaps = 0/228 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            F T  E        +E+ EKT +  E E+ SLNR++Q++EE++ERSEERL TA  KL EA
Sbjct  57   FTTTKENLATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLGEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S AADE+ R  KVLEN +   EER D L  QL EA+++AE+AD K DE +RK+A  E DL
Sbjct  117  SHAADEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            E AE R+++ ++K++ELEEELKVVGN++KSLE+SE++A+QR + Y+  I+ LT +LK+AE
Sbjct  177  EVAEDRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVEEYKRQIKTLTVKLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             RA  AE+ V KLQKEVDRLEDEL   K+RY+A++DE+DQTFAEL+GY
Sbjct  237  ARAEYAEKYVKKLQKEVDRLEDELGINKDRYRALADEMDQTFAELSGY 284

Sequence Alignment: 37. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 185.8 bits 786,  Expect = 1e-48
 Identities = 129/225 57%, Positives = 170/225 75%, Gaps = 0/225 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D  +E  ++ Q K+E AEKTA++AE ++ SLNRRIQL+EE+++R++ERL TA  KLEEA
Sbjct  57   LDKYSESLKDAQEKLEVAEKTATDAEADVASLNRRIQLVEEELDRAQERLATALTKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
             KAADESER  KV+EN  +  EE+ ++ + QL EAK IAEEAD+KY+E ARKL I E DL
Sbjct  117  EKAADESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEVARKLVIIESDL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ER E R E +E K  ELEEELK V NN+KSLE   ++ SQ+ED YEE I+ LT +LK+AE
Sbjct  177  ERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAEL 230
             RA  AER+V+KL+K +D LEDEL A+K +YKAIS+ELD  + ++
Sbjct  237  TRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALNDM 281

Sequence Alignment: 38. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 181.3 bits 766,  Expect = 3e-47
 Identities = 126/225 56%, Positives = 169/225 75%, Gaps = 0/225 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D  +E  ++ Q K+E +EK A++AE ++ SLNRRIQL+EE+++R++ERL TA +KLEEA
Sbjct  57   LDKYSEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATALQKLEEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
             KAADESER  KV+EN     EE+ ++ E QL EAK IAEEAD+KY+E ARKL I E +L
Sbjct  117  EKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGEL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ER E R E +E K  ELEEELK V N +KSLE   ++ SQ+ED YEE I+ LT +LK+AE
Sbjct  177  ERTEERAELSEGKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAE 236
Query  186  NRATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAEL 230
             RA  AERTV+KL+K +D LEDEL ++K +YKAIS+ELD+ + ++
Sbjct  237  TRAEFAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDM 281

Sequence Alignment: 39. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 178.3 bits 753,  Expect = 2e-46
 Identities = 121/195 62%, Positives = 153/195 78%, Gaps = 0/195 0%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D   E+  +   K++E +K    AE E+ +LNRRIQLLEED+ERSEERL TAT KL EA
Sbjct  57   LDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLERSEERLATATAKLAEA 116
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
            S+AADESER RK+LE+   A EER D LE QL EA+++AEEADKKYDE ARKLA+ E DL
Sbjct  117  SQAADESERARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADL 176
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAE 185
            ERAE R E+ E+K++ELEEEL+VVGNN+KSLE+SE++A+ RE+ Y++ I+ LT RLK+AE
Sbjct  177  ERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAE 236
Query  186  NRATEAERTVSKLQK 200
             RA  AER+V KLQK
Sbjct  237  ARAEFAERSVQKLQK 251

Sequence Alignment: 40. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 176.5 bits 745,  Expect = 8e-46
 Identities = 118/220 53%, Positives = 163/220 74%, Gaps = 0/220 0%
Query  14   QECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKAADESE 73
            ++    +EE EK  +  E  + +L R++Q +EED+E+SEER   A  KL EA+++ADE+ 
Sbjct  65   EQANKDLEEKEKLLTSTEANVAALTRKVQQVEEDLEKSEERSGAALSKLLEATQSADENN 124
Query  74   RNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAEARLE 133
            R  KVLEN +   EER D L  QL EA+++AE+AD K DE +RKLA  E +LE AE R++
Sbjct  125  RMCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAEDRVK 184
Query  134  AAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAER 193
            + EAK++ELEEELKVVGN++KSLE+SE +A+QR + ++  ++ LT +LK+AE RA  AE+
Sbjct  185  SGEAKIMELEEELKVVGNSLKSLEVSEDKANQRVEEFKRQLKSLTIKLKEAETRAENAEK 244
Query  194  TVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAELAGY 233
             V KLQKEVDRLED+L+ EK++YKAI D+LD TFAEL GY
Sbjct  245  NVKKLQKEVDRLEDKLMNEKDKYKAICDDLDSTFAELTGY 284

Sequence Alignment: 41. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 169.0 bits 712,  Expect = 1e-43
 Identities = 118/224 52%, Positives = 161/224 71%, Gaps = 0/224 0%
Query  7    DTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEAS 66
            D  +E  ++ Q K+E +EK A++AE E+ +LNRRIQL+EE+++R++ RL TA +KLEEA 
Sbjct  58   DKYSEALKDAQEKLELSEKKATDAEGEVAALNRRIQLIEEELDRAQGRLGTALQKLEEAE 117
Query  67   KAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLE 126
            K ADESER  KV+EN     EE+ ++ E QL EAK IAE++D+KYDE ARKL + E +LE
Sbjct  118  KQADESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARKLVVIEGELE 177
Query  127  RAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAEN 186
            RAE R E +E K  +LEEELK V N +KSLE   ++ S +ED YEE I  L ++LK+AE 
Sbjct  178  RAEERAEVSELKSGDLEEELKNVTNTLKSLEAQAEKYSDKEDKYEEEINLLNEKLKEAET 237
Query  187  RATEAERTVSKLQKEVDRLEDELLAEKERYKAISDELDQTFAEL 230
            RA  AE+TVSKL+K +D LEDEL  +K + KAI +ELD  + ++
Sbjct  238  RAEFAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDM 281

Sequence Alignment: 42. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 52.8 bits 203,  Expect = 4e-08
 Identities = 66/195 33%, Positives = 106/195 54%, Gaps = 26/195 13%
Query  14   QECQTKMEEAEKTASEAEQEIQSLNRRIQ----LLEEDMERSE---------ERLQTA-T 59
            +E +  ++ A +  SE  ++I+SL +R++    LLEE+   S+         ER + A  
Sbjct  544  RELEAALDNANRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRVALA 603
Query  60   EKLEEASKAADESERNRKVLENLNNASEERTDVLEKQLTEAKL--IAEEADKKYDEAARK 117
            ++LE+A    + +ER RK      NA  E  D    +L+E  L   +   DK+  EA   
Sbjct  604  QELEDARALLEGAERARK------NAETELADT-STRLSEITLQVTSLTNDKRRLEA--D 654
Query  118  LAITEVDLERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDL 177
            L+  + DL+ A      AE +   L  E   + + ++  + + + A       E  IR++
Sbjct  655  LSAMQSDLDDAINNQRGAEERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEIREI 714
Query  178  TQRLKDAENRAT-EAERTVSKLQKEVDRLEDELLAEKERYK 217
            T RL++AE  AT E  R V+KLQ  V  LE EL  E  R +
Sbjct  715  TIRLEEAEAFATKEGRRLVAKLQVRVRDLEAELENEARRVR 755

Sequence Alignment: 43. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 50.9 bits 195,  Expect = 2e-07
 Identities = 56/220 25%, Positives = 108/220 49%, Gaps = 16/220 7%
Query  7    DTVNEKYQ----ECQTKMEEAEKTASEAEQEIQSLNRRIQLLE---EDMERSEERLQTAT 59
            D   +K+Q    E  +++E A K    A + ++ L   ++ L    E++ R+   L +  
Sbjct  142  DKEKQKFQAEVFELLSQLETANKEKLTALKSVEKLEYTVHELNIKIEEINRTVIELTSHK 201
Query  60   EKL-EEASKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKL 118
            ++L +E ++   E    +  L+N N+  ++    + +QL + +   EE ++K        
Sbjct  202  QRLTQENTELIKEVHEVKLQLDNANHLKQQ----IAQQLEDTRHRLEEEERKRSSLENHA 257
Query  119  AITEVDLERAEARLEAAEAKVLELEEEL-KVVGNNMKSLEISEQEASQREDSYEETIRDL 177
               EV+LE  + +L+      LELE +L K  G+        E E     D  EE  R +
Sbjct  258  HTLEVELESLKVQLDDESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKM 317
Query  178  TQRLKDAENRATEAERTVSKLQKEVDRLEDE---LLAEKERYKAISDELDQTFAEL 230
             Q++ + E +        S L+K+  RL+ E   L+ + E+  A + +L++  A+L
Sbjct  318  AQKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAAAHAQQLEKRVAQL 373
 Score = 43.4 bits 162,  Expect = 3e-05
 Identities = 47/200 23%, Positives = 101/200 50%, Gaps = 16/200 8%
Query  6    FDTVNEKYQECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEA 65
            +D  N+   + Q  +++     +E +     ++R++Q   + +  ++ R Q    +LEE 
Sbjct  554  LDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEM 613
Query  66   SKAADESERNRKVLENLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDL 125
              A +++ R ++  E L+  +  R +    +LT   +    A  K +    +++  + D 
Sbjct  614  RIALEQASRAKRQAEQLHEEAVVRVN----ELTTINVNLASAKSKLES---EFSALQADY 666
Query  126  ERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEASQR----EDSYEETIRDLTQRL 181
            +     L  ++ +V +L  ELK    + K L I EQE   +    + S E+ +R L  R+
Sbjct  667  DEVHKELRISDERVQKLTIELK----STKDLLIEEQERLVKLETVKKSLEQEVRTLHVRI 722
Query  182  KDAENRATEA-ERTVSKLQKEVDRLEDELLAEKERY 216
            ++ E  A    +R ++KL+  +  +E E+  E+ R+
Sbjct  723  EEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRH 758

Sequence Alignment: 44. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 49.6 bits 189,  Expect = 3e-07
 Identities = 66/202 32%, Positives = 113/202 55%, Gaps = 31/202 15%
Query  12   KYQ-ECQTKMEEAEKTASEAEQEIQSLNRRIQ-LLEE--DMERSEERLQTATE----KLE 63
            KY+ E Q   +E E+   +  Q+I     +++ LL +   +E+ + RLQ+  E     LE
Sbjct  212  KYEAELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLE 271
Query  64   EASKAADESERNRKVLENLN----NASEERTDVLEKQLTEAKL-IAE------EADK--- 109
            +A++ A + E+    LE +N    N  EE T ++E+   E ++ IAE      E +K   
Sbjct  272  KATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQKELRVKIAELQKLQHEYEKLRD 331
Query  110  KYDEAARKLAITEVDLERAEARLEAAEAKVLELEEELKVVGNNMKSLEISEQEA----SQ 165
            + D+ AR+      DL  A+++L  A  ++ E E E+K + N    L  + +EA     Q
Sbjct  332  QRDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDELSAAYKEAETLRKQ 391
Query  166  REDSYEETIRDLTQRLKDAENRATEAERTVSKLQK----EVDRLEDELLAEKE 214
             E   +  I +L Q   D E R  + +  +  L+K    E+++L +  LAE E
Sbjct  392  EEAKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQL-NMRLAEAE 443

Sequence Alignment: 45. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 45.5 bits 171,  Expect = 7e-06
 Identities = 55/221 24%, Positives = 104/221 47%, Gaps = 14/221 6%
Query  7    DTVNEKYQ----ECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKL 62
            D   +K+Q    E   ++E A K    A++ ++ L   ++ L   +E     +   T   
Sbjct  142  DKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTVHELNIKIEEINRTVVEVTAHR 201
Query  63   EEASKAADESERNRKVLE---NLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLA 119
            +  S+  + SE  ++V E   +L+NA+  +  +  +QL + +   E+ ++K         
Sbjct  202  QRLSQ--ENSELIKEVHEYKISLDNANHLKGQI-AQQLEDTRHRLEDEERKRSSLENHAH 258
Query  120  ITEVDLERAEARLEAAEAKVLELEEEL-KVVGNNMKSLEISEQEASQREDSYEETIRDLT 178
              EV+LE  + +LE      LELE +L K  G+        E E     D  EE  R + 
Sbjct  259  TLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMA 318
Query  179  QRLKDAENRATEAERTVSKLQKEVDRLEDE---LLAEKERYKAISDELDQTFAEL 230
            Q++ +   +        S L+K+  RL+ E   L+ + E+  A +  L++  ++L
Sbjct  319  QKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQL 373
 Score = 41.6 bits 154,  Expect = 0.0001
 Identities = 52/198 26%, Positives = 102/198 51%, Gaps = 14/198 7%
Query  17   QTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKLE-EASKAADESERN 75
            QT+  + EK  ++ E+EI++L ++ Q+   ++E+   RL  A  KL+ E ++   + +  
Sbjct  491  QTR-HDYEKRLAQKEEEIEALRKQYQI---EIEQLNMRLAEAEAKLKTEVARLKKKYQAQ 546
Query  76   RKVLE-NLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLAITEVDLERAEARLEA 134
               LE +L+ A++   D L+K + +  L        YDE  R+L      L   + R +A
Sbjct  547  ITELELSLDAANKANID-LQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRCQA 605
Query  135  AEAKVLELEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAERT 194
              A++    EE++V   N++    +++ A Q  +     + +LT    +  +  ++ E  
Sbjct  606  LTAEL----EEMRV---NLEQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETE 658
Query  195  VSKLQKEVDRLEDELLAEKERYKAISDELDQT 226
             S LQ + D +  EL    ER + ++ E+  T
Sbjct  659  FSALQNDYDEVHKELRISDERVQKLTIEVKST 690

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.