The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

PTSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIA
AIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQY
IPNTNGTDGVCYWLSYYQPPRQMSSR
Sequence Info Allergen Name Length Opt Bits Score E Value
P16968 Hor v 1 146 1057 173.0 2.9e-45
P16968 Hor v 15.0101 146 1057 173.0 2.9e-45
BAA02000 Ory s TAI 166 523 90.8 1.8e-20
BAA01998 Ory s TAI 165 520 90.3 2.5e-20
BAA07711 Ory s TAI 160 510 88.8 7.3e-20
BAA07710 Ory s TAI 166 499 87.1 2.4e-19
BAA01997 Ory s TAI 162 492 86.0 5e-19
BAA07713 Ory s TAI 160 480 84.1 1.8e-18
BAA01996 Ory s TAI 157 461 81.2 1.3e-17
BAA07712 Ory s TAI 157 453 80.0 3.2e-17
CAA08836 Hor v 1 152 446 78.9 6.6e-17
P01083 Tri a TAI 123 418 74.4 1.2e-15
CBA13560 Tri a 15.0101 121 397 71.2 1.1e-14
BAA07773 Ory s TAI 109 376 67.8 9.8e-14
BAA07774 Ory s TAI 113 368 66.6 2.3e-13
BAA07772 Ory s TAI 111 357 64.9 7.5e-13
P01085 Tri a TAI 124 339 62.2 5.5e-12
P01084 Tri a TAI 124 332 61.1 1.2e-11
CAI84642 Tri a 28.0101 119 329 60.7 1.6e-11
AAB99797 Ory s TAI 157 288 54.5 1.4e-09
BAA01999 Ory s TAI 95 268 51.1 9.4e-09
P10846 Tri a TAI 44 160 33.9 0.00064
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 173.0 bits 1057,  Expect = 3e-45
 Identities = 146/146 100%, Positives = 146/146 100%, Gaps = 0/146 0%
Query  1    PTSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIA 60
            PTSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIA
Sbjct  1    PTSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIA 60
Query  61   AIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQY 120
            AIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQY
Sbjct  61   AIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQY 120
Query  121  IPNTNGTDGVCYWLSYYQPPRQMSSR 146
            IPNTNGTDGVCYWLSYYQPPRQMSSR
Sbjct  121  IPNTNGTDGVCYWLSYYQPPRQMSSR 146

Sequence Alignment: 2. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 173.0 bits 1057,  Expect = 3e-45
 Identities = 146/146 100%, Positives = 146/146 100%, Gaps = 0/146 0%
Query  1    PTSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIA 60
            PTSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIA
Sbjct  1    PTSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIA 60
Query  61   AIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQY 120
            AIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQY
Sbjct  61   AIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQY 120
Query  121  IPNTNGTDGVCYWLSYYQPPRQMSSR 146
            IPNTNGTDGVCYWLSYYQPPRQMSSR
Sbjct  121  IPNTNGTDGVCYWLSYYQPPRQMSSR 146

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 90.8 bits 523,  Expect = 2e-20
 Identities = 77/135 57%, Positives = 94/135 69%, Gaps = 9/135 6%
Query  3    SVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG-----GQVVESIQKDCCR 57
            ++A  +   V  S GE C PGMGYP+Y +PRCRA+VK QC G     G V E +++DCCR
Sbjct  24   TMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCR 83
Query  58   QIAAIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVC 117
            Q+AA+ D WC C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA C
Sbjct  84   QLAAVDDSWCRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFC 141
Query  118  NQYIPNTNGTDGVCYWLSYYQPPR 141
            N  IPN  GT GVCYWL Y + PR
Sbjct  142  NVDIPN--GTGGVCYWLGYPRTPR 163

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 90.3 bits 520,  Expect = 3e-20
 Identities = 77/136 56%, Positives = 93/136 68%, Gaps = 8/136 5%
Query  2    TSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG----GQVVESIQKDCCR 57
            T +A  +   V  S GE C PGMGYP+Y +PRCRA+VK QC G    G V E + +DCCR
Sbjct  23   TRMADHHKDQVVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCR 82
Query  58   QIAAIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVC 117
            ++AA+ D WC C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA C
Sbjct  83   ELAAVDDSWCRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFC 140
Query  118  NQYIPNTNGTDGVCYWLSYYQPPR 141
            N  IPN  GT GVCYWL Y + PR
Sbjct  141  NVDIPN--GTGGVCYWLGYPRTPR 162

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 88.8 bits 510,  Expect = 7e-20
 Identities = 76/126 60%, Positives = 90/126 71%, Gaps = 10/126 7%
Query  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG-----GQVVESIQKDCCRQIAAIGDEW 66
            V  S GE C PGMGYP+Y +PRCRA+VK QC G     G V E +++DCCRQ+AA+ D W
Sbjct  26   VVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSW 85
Query  67   CICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNG 126
            C C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA CN  IP  NG
Sbjct  86   CRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIP--NG 141
Query  127  TDGVCYWLSYY-QPPR 141
            T GVCYWL Y  + PR
Sbjct  142  TGGVCYWLGYTPRTPR 157

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 87.1 bits 499,  Expect = 2e-19
 Identities = 73/126 57%, Positives = 88/126 69%, Gaps = 9/126 7%
Query  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG-----GQVVESIQKDCCRQIAAIGDEW 66
            V  S GE C PGMGYP+Y +PRCRA+VK QC        +  E +++DCCRQ+AA+ D W
Sbjct  33   VVYSLGERCQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSW 92
Query  67   CICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNG 126
            C C AL  M G +Y+ELG    D    +AEVFPGCR   ++RA ASLPA CN  IP  NG
Sbjct  93   CRCSALNHMVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIP--NG 148
Query  127  TDGVCYWLSYYQPPR 141
            T GVCYWL Y + PR
Sbjct  149  TGGVCYWLGYPRTPR 163

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 86.0 bits 492,  Expect = 5e-19
 Identities = 70/123 56%, Positives = 84/123 68%, Gaps = 7/123 5%
Query  15   SPGEWCWPGMGYPVYPFPRCRALVKSQCAG-GQVV--ESIQKDCCRQIAAIGDEWCICGA 71
            SPGE C PG+ YP Y +P+CR LV+ QC G G     E + +DCCRQ+AA+ D WC CGA
Sbjct  34   SPGEQCRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGA 93
Query  72   LGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVC 131
            L  M   +Y+ELG   A     +AEVFPGCR   ++RA ASLPA CN  IPN  G  GVC
Sbjct  94   LDHMLSGIYRELGATEAGHP--MAEVFPGCRRGDLERAAASLPAFCNVDIPN--GPGGVC 149
Query  132  YWLSYYQPPR 141
            YWL Y + PR
Sbjct  150  YWLGYPRTPR 159

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 84.1 bits 480,  Expect = 2e-18
 Identities = 67/120 55%, Positives = 83/120 69%, Gaps = 7/120 5%
Query  12   VSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAG---GQVVESIQKDCCRQIAAIGDEWCI 68
            V  +P   C PG

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.