The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

QETCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTY
SDIDGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAH
KARLERPQIRVPPPAPEKA
Sequence Info Allergen Name Length Opt Bits Score E Value
CAI94601 Par j 1.0103 139 989 217.6 1e-58
P43217 Par j 1 139 985 216.7 1.8e-58
O04404 Par j 1 176 964 212.2 5.2e-57
CAA54587 Par j 1.0101 133 941 207.4 1.1e-55
Q40905 Par j 1 138 660 147.7 1.1e-37
O04403 Par j 2 133 350 81.9 6.9e-18
P55958 Par j 2 133 344 80.6 1.7e-17
A0A059SSZ0 Pun g 1.0201 120 238 58.1 8.9e-11
A0A059STC4 Pun g 1.0101 120 236 57.6 1.2e-10
NP_001316123 Sola l 7.0101 115 234 57.2 1.5e-10
P82007 Hel a 3.0101 116 228 56.0 3.8e-10
O04004 Amb a 6 118 227 55.7 4.4e-10
AAB42069 Lyc e 3 114 224 55.1 6.7e-10
P93224 Sola l 3.0101 114 224 55.1 6.7e-10
P19656-1 Zea m 14.0101 120 222 54.7 9.4e-10
P19656-2 Zea m 14.0102 128 222 54.7 1e-09
QIN55516 Art ca 3.0102 117 215 53.2 2.6e-09
W0U0V5 Can s 3.0101 91 208 51.7 5.5e-09
ANC85027 Art si 3.0102 116 203 50.6 1.5e-08
ACE07187 Art v 3.0202 116 203 50.6 1.5e-08
ANC85020 Art ar 3.0102 116 203 50.6 1.5e-08
CAL07989 Pla a 3.0101 118 203 50.6 1.5e-08
AAL25839 Hev b 12 116 202 50.4 1.7e-08
P85894 Mor n 3.0101 91 198 49.6 2.4e-08
ABY21307 Pla or 3.0101 118 199 49.8 2.7e-08
P81402 Pru p 3 91 197 49.4 2.8e-08
ANC85025 Art la 3.0102 115 198 49.6 3.1e-08
EU564847 Art v 3.0301 117 198 49.6 3.1e-08
ANC85023 Art gm 3.0102 117 197 49.4 3.6e-08
A0AT29 Len c 3.0101 118 197 49.4 3.7e-08
A0A059ST23 Pun g 1.0301 120 197 49.4 3.7e-08
ACV04796 Api g 2 118 196 49.2 4.3e-08
ABX56711 Ara h 9.0101 116 195 48.9 4.8e-08
ANC85017 Art an 3.0101 117 195 48.9 4.9e-08
ANC85021 Art ca 3.0101 117 195 48.9 4.9e-08
19846220 Tri a 14.0101 90 193 48.5 5e-08
CAB96876 Pru p 3 91 193 48.5 5e-08
ANC85022 Art gm 3.0101 117 192 48.3 7.6e-08
ANC85026 Art si 3.0101 116 191 48.1 8.7e-08
ABX75045 Ara h 9.0201 92 189 47.7 9.1e-08
ABU95
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.