The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLT
IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM
CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI
GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF
VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP
SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPI
VTGKQNPVACGAPATPAAP
Sequence Info Allergen Name Length Opt Bits Score E Value
AHL24657 Sal k 6.0101 379 2566 591.3 2.3e-170
ARS33724 Sal k 6.0101 401 2566 591.3 2.5e-170
ABY21306 Pla or 2.0101 378 1238 288.6 3.1e-79
Q6H9K0 Pla a 2 377 1232 287.2 8e-79
A0A077B155 Sor h 13.0101 422 1105 258.2 4.7e-70
A0A077B569 Sor h 13.0201 410 1101 257.3 8.6e-70
CAB42886 Phl p 13 394 1042 243.9 9.2e-66
W8PPL3 Ole e 14.0101 379 1028 240.7 8e-65
P43212 Cry j 2 514 797 188.0 8.1e-49
BAA06172 Cry j 2 514 797 188.0 8.1e-49
Q7M1E7 Cha o 2.0101 514 793 187.1 1.5e-48
CAC05582 Jun a 2 507 740 175.0 6.5e-45
C9EA45 Cari p 1.0101 494 710 168.2 7.2e-43
C0HKB1 Cup s 2.0101 164 145 39.9 0.0001
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sal k 6.0101 Sequence ID: AHL24657

 Score = 591.3 bits 2566,  Expect = 2e-170
 Identities = 379/379 100%, Positives = 379/379 100%, Gaps = 0/379 0%
Query  1    QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLT 60
            QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLT
Sbjct  1    QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLT 60
Query  61   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 120
            IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM
Sbjct  61   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 120
Query  121  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 180
            CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI
Sbjct  121  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 180
Query  181  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 240
            GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF
Sbjct  181  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 240
Query  241  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 300
            VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP
Sbjct  241  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 300
Query  301  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPI 360
            SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPI
Sbjct  301  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPI 360
Query  361  VTGKQNPVACGAPATPAAP 379
            VTGKQNPVACGAPATPAAP
Sbjct  361  VTGKQNPVACGAPATPAAP 379

Sequence Alignment: 2. Allergen Name: Sal k 6.0101 Sequence ID: ARS33724

 Score = 591.3 bits 2566,  Expect = 3e-170
 Identities = 379/379 100%, Positives = 379/379 100%, Gaps = 0/379 0%
Query  1    QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLT 60
            QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLT
Sbjct  23   QGPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPLT 82
Query  61   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 120
            IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM
Sbjct  83   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 142
Query  121  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 180
            CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI
Sbjct  143  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 202
Query  181  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 240
            GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF
Sbjct  203  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 262
Query  241  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 300
            VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP
Sbjct  263  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 322
Query  301  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPI 360
            SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPI
Sbjct  323  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQCKNVKPI 382
Query  361  VTGKQNPVACGAPATPAAP 379
            VTGKQNPVACGAPATPAAP
Sbjct  383  VTGKQNPVACGAPATPAAP 401

Sequence Alignment: 3. Allergen Name: Pla or 2.0101 Sequence ID: ABY21306

 Score = 288.6 bits 1238,  Expect = 3e-79
 Identities = 172/365 47%, Positives = 243/365 66%, Gaps = 8/365 2%
Query  2    GPIDITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCK-APLT 60
            G  ++  +GAK + D + A++ AW+ ACA+  P+ +++P G +++  V L+GPCK + + 
Sbjct  9    GTFNVNDYGAKGSGDISQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLLEGPCKGSKIG 68
Query  61   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 120
             ++ G  KAPADV+  K E  WV   +V GLT++     GTFDGQGQ AW  N C +   
Sbjct  69   FQLDGVVKAPADVSAFKSEG-WVVFNHVDGLTVS---GKGTFDGQGQKAWAANNCDKDEN 124
Query  121  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 180
            CN  P N RFN L NA +  I S+NSK++H+ V+ C NI++  +TI AP  S+NTDG+HI
Sbjct  125  CNRPPMNIRFNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINTDGIHI 184
Query  181  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 240
            G S GV  T++ I TGDDC+S+G G+ +V V  + CGPGHGIS+GS+GK+ +E    GI 
Sbjct  185  GLSRGVTITDTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKDVRGIT 244
Query  241  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 300
            V  C+FT T NGVR+K+W +S    A+D+ FED+T+ NV NPVI+DQEYCPY +C  K P
Sbjct  245  VTGCTFTGTSNGVRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQEYCPYGQCSLKAP 304
Query  301  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTF--PGGAAVSQCKNVK 358
            S+VKLS I F N+ G +   + + + CS   PC  +E+ +I+L +   G  A S C N K
Sbjct  305  SRVKLSNIKFNNIRGTSSGPDAIVIACSHGFPCSNLEIGEINLALHAAGAPANSTCTNAK 364
Query  359  PIVTGKQNP-VAC 370
            PI +GKQ P + C
Sbjct  365  PIFSGKQVPAIKC 377

Sequence Alignment: 4. Allergen Name: Pla a 2 Sequence ID: Q6H9K0

 Score = 287.2 bits 1232,  Expect = 8e-79
 Identities = 168/362 46%, Positives = 247/362 68%, Gaps = 8/362 2%
Query  5    DITKFGAKPNADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCK-APLTIEI 63
            ++  +GAK   D + A++ AWK ACA+  P+ +++P G + +  V +QGPCK + +  +I
Sbjct  11   NVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGSKIGFQI 70
Query  64   AGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGMCNS 123
             G  KAPAD ++ K  D WV    + GLT++     GT+DGQGQ AW +N C ++  C  
Sbjct  71   DGVVKAPADPSKFKS-DGWVSFYRIDGLTVSGT---GTLDGQGQTAWAKNNCDKNPNCKH 126
Query  124  LPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHIGRS 183
               N+RF+ L +A +  I SLNSK++H+ V+ C++IT+  +T+ AP  S+NTDG+H+G S
Sbjct  127  AAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVGIS 186
Query  184  NGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIFVKN 243
             GV  TN+KI TGDDCIS+G G+ +V +  + CGPGHGISIGS+G++ NE    GI VK 
Sbjct  187  KGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGITVKG 246
Query  244  CSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTPSKV 303
            C+F+ T NGVR+K+W NS   +A+DL F+D+T+ NV NPVI+DQEYCPY +C  + PS++
Sbjct  247  CTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQAPSRI 306
Query  304  KLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTF--PGGAAVSQCKNVKPIV 361
            KLS I+F N+ G +     V + CS  +PC  +++ +I+L++   GG A S C NVKP  
Sbjct  307  KLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVKPTF 366
Query  362  TGKQNP-VAC 370
            +GKQ P + C
Sbjct  367  SGKQVPAIKC 376

Sequence Alignment: 5. Allergen Name: Sor h 13.0101 Sequence ID: A0A077B155

 Score = 258.2 bits 1105,  Expect = 5e-70
 Identities = 159/364 43%, Positives = 237/364 65%, Gaps = 10/364 2%
Query  2    GPIDITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPL 59
            G  DI+K+GAK +   D+T AL  AW  AC    P  +++P G++L   + + GPCK  +
Sbjct  53   GGSDISKLGAKGDGKTDSTKALNEAWAAACGKEGPQTLMIPKGDYLTGPLNFSGPCKGSV 112
Query  60   TIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSG 119
            TI++ GN+    D++  K    W++IE+V  L I+     GT+DGQG+  W  NKCAQ  
Sbjct  113  TIQLDGNLLGTTDLSAYK--TNWIEIEHVDNLVIS---GKGTLDGQGKQVWDNNKCAQKY 167
Query  120  MCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMH 179
             C  LP ++ ++ + N ++SGI  LN+K++HM V  CK +T+  +T+ AP DS NTDG+H
Sbjct  168  DCKILPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIH 227
Query  180  IGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGI 239
            IG S+ V  T + IG GDDCIS+G G+  ++V G+TCGPGHGIS+GS+G++ +E   T I
Sbjct  228  IGDSSKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTDI 287
Query  240  FVKNCSFTDTDNGVRIKSWMNSFEA-SASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEK 298
             VK+C++  T NGVRIKS+ ++    +AS LH+E+I + +V NP+IID +YCP   C  K
Sbjct  288  NVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKYCPNKICTAK 347
Query  299  TPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPG--GAAVSQCKN 356
              SKV +  ++FKN+ G + + E V LLCS  +PC GV + +I + + G     ++ C+N
Sbjct  348  GDSKVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVEYKGTNNKTMAVCQN 407
Query  357  VKPIVTGKQNPVAC 370
             K   TG    +AC
Sbjct  408  AKGSATGCLKELAC 421

Sequence Alignment: 6. Allergen Name: Sor h 13.0201 Sequence ID: A0A077B569

 Score = 257.3 bits 1101,  Expect = 9e-70
 Identities = 158/364 43%, Positives = 236/364 64%, Gaps = 10/364 2%
Query  2    GPIDITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAPL 59
            G  DI+K+GA  +   D+T A+  AW  AC       I++P G++L+  + + GPCK  +
Sbjct  41   GSFDISKLGASGDGKKDSTKAVQEAWTSACGGTGKQTILIPKGDYLVGPLNFTGPCKGDV 100
Query  60   TIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSG 119
            TI++ GN+ A  D++Q KG   W++I  V  L IT     G +DGQG A W +N CA+  
Sbjct  101  TIQVDGNLLATTDLSQYKGN--WIEILRVDNLVIT---GKGKLDGQGPAVWSKNSCAKKY 155
Query  120  MCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMH 179
             C  LP ++ ++ + N ++SGI  LN+K++HM V  CK +T+  +T+ AP DS NTDG+H
Sbjct  156  DCKILPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIH 215
Query  180  IGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGI 239
            IG S+ V  T + IG GDDCIS+G G+  ++V G+TCGPGHGIS+GS+G++ +E   T I
Sbjct  216  IGDSSKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTDI 275
Query  240  FVKNCSFTDTDNGVRIKSWMNSFEA-SASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEK 298
             VK+C++  T NGVRIKS+ ++    +AS LH+E+I + +V NP+IID +YCP   C  K
Sbjct  276  NVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKYCPNKICTAK 335
Query  299  TPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPG--GAAVSQCKN 356
              SKV +  ++FKN+ G + + E V LLCS  +PC GV + +I + + G     ++ C+N
Sbjct  336  GDSKVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVEYKGTNNKTMAVCQN 395
Query  357  VKPIVTGKQNPVAC 370
             K   TG    +AC
Sbjct  396  AKGSATGCLKELAC 409

Sequence Alignment: 7. Allergen Name: Phl p 13 Sequence ID: CAB42886

 Score = 243.9 bits 1042,  Expect = 9e-66
 Identities = 155/366 42%, Positives = 233/366 63%, Gaps = 12/366 3%
Query  2    GPIDITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAP- 58
            G  DITK+GAKP+   D T  +  AW  AC       IV+P G+FL   + + GPCK   
Sbjct  22   GTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFTGPCKGDS 81
Query  59   LTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQS 118
            +TI++ GN+ +  D+A+ K    W++I  ++ LTIT     GT+DGQG+A W +N CA++
Sbjct  82   VTIKLDGNLLSSNDLAKYKAN--WIEIMRIKKLTIT---GKGTLDGQGKAVWGKNSCAKN 136
Query  119  GMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGM 178
              C  LP  + ++   +A I GI  LN+K++HM +  CK +T+  +TI AP DS NTDG+
Sbjct  137  YNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNTDGI 196
Query  179  HIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTG 238
            HIG S+ V  T++ IGTGDDCIS+G G+  +++ G+TCGPGHGIS+GS+G++ +E   T 
Sbjct  197  HIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKDVTD 256
Query  239  IFVKNCSFTDTDNGVRIKSWMNSFEA-SASDLHFEDITVTNVLNPVIIDQEYCPYNHCKE 297
            I VKNC +  + NG+RIKS+ ++    +AS L +E++ + +V  P+IIDQ+YCP   C  
Sbjct  257  ITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKICTS 316
Query  298  KTPS-KVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPG--GAAVSQC 354
            K  S +V +  ++F+N+ G + + E V LLCS   PC+GV + D+ + + G     ++ C
Sbjct  317  KGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKTMAVC 376
Query  355  KNVKPIVTGKQNPVACGA 372
             N K    G      C A
Sbjct  377  TNAKVTAKGVSEANTCAA 394

Sequence Alignment: 8. Allergen Name: Ole e 14.0101 Sequence ID: W8PPL3

 Score = 240.7 bits 1028,  Expect = 8e-65
 Identities = 166/356 46%, Positives = 228/356 64%, Gaps = 17/356 4%
Query  5    DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAP--LT 60
            D+ K+GAK +   D   A++ AWK AC +  PAK+V+P G+F+   V +QGPC AP  +T
Sbjct  17   DVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKPIT 76
Query  61   IEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSGM 120
            IEI GN  A  DV+      +W+ +E + GL I     GGT +G+G+++W+       G 
Sbjct  77   IEIQGNVLASTDVSAYTS-GSWIMLEEIDGLVIN---GGGTINGRGKSSWQFAGANNEGP 132
Query  121  CNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGMHI 180
               LP ++ F  + N+++  +  ++S  +H  V   +NI ++ L I AP DS NTDGMHI
Sbjct  133  L--LPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHI 190
Query  181  GRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTGIF 240
              S  V+ T+S IGTGDDC+S+G G  D+ V GITCGPGHGIS+GS+GK  +E    GI 
Sbjct  191  SCSTNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGIS 250
Query  241  VKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCKEKTP 300
            V NC++T T NG RIK++  S    ASD+ ++DI VT+V NP++IDQ Y   +  K+   
Sbjct  251  VINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQHY---DSKKKPEQ 307
Query  301  SKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQ---CKNV 357
            SKVK+S + F N+ G   S   V L CS AVPC+ VELADIDL  P GAA S    C N 
Sbjct  308  SKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLA-PSGAAGSLKSVCANA 366
Query  358  KPIVTGKQNPVAC 370
            K ++ GK  P  C
Sbjct  367  KFVLKGKPIPPGC 379

Sequence Alignment: 9. Allergen Name: Cry j 2 Sequence ID: P43212

 Score = 188.0 bits 797,  Expect = 8e-49
 Identities = 127/365 34%, Positives = 213/365 58%, Gaps = 19/365 5%
Query  5    DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLTI 61
            ++ K+GA  +   D T A+  AW+ AC   + A ++VP  + F++N + + GPC+  +T 
Sbjct  60   NVEKYGAVGDGKHDCTEAFSTAWQAACKKPS-AMLLVPGNKKFVVNNLFFNGPCQPHFTF 118
Query  62   EIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQ-SG- 119
            ++ G   A  + A  K    W++   + G+T   L   G  DGQG+  W   +C   +G 
Sbjct  119  KVDGIIAAYQNPASWKNNRIWLQFAKLTGFT---LMGKGVIDGQGKQWWA-GQCKWVNGR 174
Query  120  -MCNSL--PYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTD 176
             +CN    P   +F+  T   I G+K +NS  +H+    C+ + + G++I AP+DS NTD
Sbjct  175  EICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTD 234
Query  177  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 236
            G+ I  S   H   + IGTGDDC+++G G+ ++ +E + CGPGHGISIGS+G+  + A  
Sbjct  235  GIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEV 294
Query  237  TGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 296
            + + V    F DT NG+RIK+W       AS + +E++ + N  NP++I+Q YC      
Sbjct  295  SYVHVNGAKFIDTQNGLRIKTWQGG-SGMASHIIYENVEMINSENPILINQFYCTSASAC 353
Query  297  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQC-- 354
            +   S V++  +++KN+ G + +A  ++L CS ++PC  ++L+DI L +  G  ++ C  
Sbjct  354  QNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGK-IASCLN 412
Query  355  KNVKPIVTGKQNPVACGAPATPAA 378
             N     +G   P AC    +P+A
Sbjct  413  DNANGYFSGHVIP-ACKN-LSPSA 434

Sequence Alignment: 10. Allergen Name: Cry j 2 Sequence ID: BAA06172

 Score = 188.0 bits 797,  Expect = 8e-49
 Identities = 127/365 34%, Positives = 213/365 58%, Gaps = 19/365 5%
Query  5    DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLTI 61
            ++ K+GA  +   D T A+  AW+ AC   + A ++VP  + F++N + + GPC+  +T 
Sbjct  60   NVEKYGAVGDGKHDCTEAFSTAWQAACKNPS-AMLLVPGSKKFVVNNLFFNGPCQPHFTF 118
Query  62   EIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQ-SG- 119
            ++ G   A  + A  K    W++   + G+T   L   G  DGQG+  W   +C   +G 
Sbjct  119  KVDGIIAAYQNPASWKNNRIWLQFAKLTGFT---LMGKGVIDGQGKQWWA-GQCKWVNGR 174
Query  120  -MCNSL--PYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTD 176
             +CN    P   +F+  T   I G+K +NS  +H+    C+ + + G++I AP+DS NTD
Sbjct  175  EICNDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTD 234
Query  177  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 236
            G+ I  S   H   + IGTGDDC+++G G+ ++ +E + CGPGHGISIGS+G+  + A  
Sbjct  235  GIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEV 294
Query  237  TGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 296
            + + V    F DT NG+RIK+W       AS + +E++ + N  NP++I+Q YC      
Sbjct  295  SYVHVNGAKFIDTQNGLRIKTWQGG-SGMASHIIYENVEMINSENPILINQFYCTSASAC 353
Query  297  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQC-- 354
            +   S V++  +++KN+ G + +A  ++L CS ++PC  ++L+DI L +  G  ++ C  
Sbjct  354  QNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGK-IASCLN 412
Query  355  KNVKPIVTGKQNPVACGAPATPAA 378
             N     +G   P AC    +P+A
Sbjct  413  DNANGYFSGHVIP-ACKN-LSPSA 434

Sequence Alignment: 11. Allergen Name: Cha o 2.0101 Sequence ID: Q7M1E7

 Score = 187.1 bits 793,  Expect = 2e-48
 Identities = 126/358 35%, Positives = 210/358 58%, Gaps = 18/358 5%
Query  5    DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLTI 61
            ++ ++GA  +   D+T A+   W  AC  A+ A ++VPA + F++N + ++GPC+  L+ 
Sbjct  60   NVEQYGAVGDGKHDSTEAFATTWNAACKKAS-AVLLVPANKKFFVNNLVFRGPCQPHLSF 118
Query  62   EIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQSG-- 119
            ++ G   A  D A+ K    W++      LT   L   G  DGQGQ  W       +G  
Sbjct  119  KVDGTIVAQPDPARWKNSKIWLQFAQ---LTDFNLMGTGVIDGQGQQWWAGQCKVVNGRT 175
Query  120  MCN--SLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMG-CKNITLTGLTIDAPKDSLNTD 176
            +CN  + P   + +   +  +  +  +NS  +H+ V G C+ + + GL I AP+DS NTD
Sbjct  176  VCNDRNRPTAIKIDYSKSVTVKELTLMNSPEFHL-VFGECEGVKIQGLKIKAPRDSPNTD 234
Query  177  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 236
            G+ I  S   H     IGTGDDCI++G G+ ++ ++ + CGPGHGISIGS+G+  + A  
Sbjct  235  GIDIFASKRFHIEKCVIGTGDDCIAIGTGSSNITIKDLICGPGHGISIGSLGRDNSRAEV 294
Query  237  TGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNHCK 296
            + + V    F DT NG+RIK+W       AS + +E++ + N  NP++I+Q YC      
Sbjct  295  SHVHVNRAKFIDTQNGLRIKTWQGG-SGLASYITYENVEMINSENPILINQFYCTSASAC 353
Query  297  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQC-- 354
            +   S V++  +++KN+HG + +A  ++L+CS +VPC G++L+++ L +  G   S C  
Sbjct  354  QNQRSAVQIQGVTYKNIHGTSATAAAIQLMCSDSVPCTGIQLSNVSLKLTSGKPAS-CVD 412
Query  355  KNVKPIVTGKQNPVAC 370
            KN +   +G+  P  C
Sbjct  413  KNARGFYSGRLIPT-C 427

Sequence Alignment: 12. Allergen Name: Jun a 2 Sequence ID: CAC05582

 Score = 175.0 bits 740,  Expect = 7e-45
 Identities = 123/356 34%, Positives = 204/356 57%, Gaps = 22/356 6%
Query  5    DITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLTI 61
            ++  +GA  +   D+T A+   W  AC   + A  +VPA + F++N + + GPC+  ++ 
Sbjct  61   NVEHYGAVGDGKHDSTDAFEKTWNAACNKLS-AVFLVPANKKFVVNNLVFYGPCQPHFSF 119
Query  62   EIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQ-SG- 119
            ++ G   A  D A+ K    W+       LT   L   G  DGQG   W  ++C   +G 
Sbjct  120  KVDGTIAAYPDPAKWKNSKIWMHFAR---LTDFNLMGTGVIDGQGNR-WWSDQCKTINGR 175
Query  120  -MCNSL--PYNFRFNTLTNAQISGIKSLNSKLYHMGVMG-CKNITLTGLTIDAPKDSLNT 175
             +CN    P   + +   +  +  +   NS  +H+ V G C  + + G+ I AP+DS NT
Sbjct  176  TVCNDKGRPTAIKIDFSKSVTVKELTLTNSPEFHL-VFGECDGVKIQGIKIKAPRDSPNT 234
Query  176  DGMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAP 235
            DG+ I  S         IGTGDDC+++G G+ ++ ++ +TCGPGHG+SIGS+GK  + + 
Sbjct  235  DGIDIFASKRFEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSE 294
Query  236  NTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNH- 294
             + + +    F DT NG+RIK+W       AS + +E++ + N  NP++I+Q YC     
Sbjct  295  VSFVHLDGAKFIDTQNGLRIKTWQGG-SGLASHITYENVEMINAENPILINQFYCTSAAA 353
Query  295  CKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPGGAAVSQC 354
            CK +  S VK+  ++FKN+HG + +   ++L+CS +VPC  ++L+++ L +  G  V+ C
Sbjct  354  CKNQR-SAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVFLKLTSGK-VATC 411
Query  355  --KNVKPIVTGKQNPVAC 370
              KN     T   NP +C
Sbjct  412  VNKNANGYYTNPLNP-SC 428

Sequence Alignment: 13. Allergen Name: Cari p 1.0101 Sequence ID: C9EA45

 Score = 168.2 bits 710,  Expect = 7e-43
 Identities = 113/330 34%, Positives = 194/330 58%, Gaps = 17/330 5%
Query  5    DITKFGAKPNA---DATSALLAAWKEACAAAAPAKIVVPAGE-FLLNAVKLQGPCKAPLT 60
            ++  FGA+ +    D    +  AW++AC+   PA  +VP    +L+  +++ GPCK+ L 
Sbjct  118  NVDDFGAEGDGIHDDTQQVFEEAWEKACSYKGPALFLVPERRTYLIGPIRFLGPCKSNLV 177
Query  61   IE--IAGNFKAPADVAQMKGEDT-WVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQ 117
            I+  I+G   A  + +  + +   W+ I++V  L +     GGT  G GQ  W+ N C  
Sbjct  178  IQVQISGTILASDNRSDYRKDPRHWIVIDSVDNLLVE---GGGTIHGNGQIWWR-NSC-- 231
Query  118  SGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDG 177
               C   P    F    N  +  +K  +++  ++    C  +T + LT+ AP+ S NTDG
Sbjct  232  KAPCKEAP-TVTFYKCKNLMVRNVKVQDAQQMQVSFEKCSEVTASDLTVTAPEKSPNTDG 290
Query  178  MHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNT 237
            +H+  +  +  TN+ IG GDDCIS+  G+ +V++E +TCGPGHGI++ S+G   ++A  +
Sbjct  291  IHVTNTQNILITNTFIG-GDDCISIESGSHNVQIEELTCGPGHGINVDSLGDNNSKAFVS 349
Query  238  GIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVIIDQEYCPYNH-CK 296
             + V    ++ T NGVRIK++      SAS++ F+++ + NV NP+IIDQ YC     CK
Sbjct  350  FVTVNGAKLSGTTNGVRIKTYQGG-SGSASNIKFQNVDMENVKNPIIIDQNYCDQKKPCK 408
Query  297  EKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDL 343
            ++  S V++  + ++N++G + S   + + CS   PC GV+L ++ L
Sbjct  409  KQQKSAVQVKDVLYQNIQGNSASDVAIDFDCSENYPCLGVKLQNVRL 455

Sequence Alignment: 14. Allergen Name: Cup s 2.0101 Sequence ID: C0HKB1

 Score = 39.9 bits 145,  Expect = 0.0001
 Identities = 26/62 41%, Positives = 38/62 61%, Gaps = 9/62 14%
Query  214  ITCGPGHGISIGSMGKFANEAPNTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFED 273
            +TCGPGHG+SIGS+GK  + +  + + +    F DT NG+R             D+ F++
Sbjct  98   LTCGPGHGMSIGSLGKGNSRSEVSFVHLDGAKFIDTQNGLRSA-------VKIEDVTFKN 150
Query  274  IT--VTNVLNP 282
                 TN LNP
Sbjct  151  ANGYYTNPLNP 161

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.