The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK
LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGV
ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD
YLKNIWKVMNWKYASEVYAKECPSS
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB53458 Hev b 10.0102 205 1397 325.3 8.2e-91
AAA16792 Hev b 10.0101 233 1392 324.1 2.1e-90
CAC13961 Hev b 10.0103 205 1386 322.8 4.6e-90
EF470980 Pis v 4.0101 230 1251 292.0 9.9e-81
Q92450 Asp f 6 210 670 159.6 6.5e-41
AAB60779 Asp f 6 221 670 159.5 6.9e-41
CAD68071 Mala s 11 237 658 156.8 5e-40
P86254 Alt a 14.0101 25 121 38.3 2.5e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hev b 10.0102 Sequence ID: CAB53458

 Score = 325.3 bits 1397,  Expect = 8e-91
 Identities = 205/205 100%, Positives = 205/205 100%, Gaps = 0/205 0%
Query  1    QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 60
            QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK
Sbjct  1    QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 60
Query  61   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGV 120
            LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGV
Sbjct  61   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGV 120
Query  121  ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD 180
            ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD
Sbjct  121  ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD 180
Query  181  YLKNIWKVMNWKYASEVYAKECPSS 205
            YLKNIWKVMNWKYASEVYAKECPSS
Sbjct  181  YLKNIWKVMNWKYASEVYAKECPSS 205

Sequence Alignment: 2. Allergen Name: Hev b 10.0101 Sequence ID: AAA16792

 Score = 324.1 bits 1392,  Expect = 2e-90
 Identities = 204/205 99%, Positives = 204/205 99%, Gaps = 0/205 0%
Query  1    QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 60
            QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK
Sbjct  29   QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 88
Query  61   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGV 120
            LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEG 
Sbjct  89   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGA 148
Query  121  ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD 180
            ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD
Sbjct  149  ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD 208
Query  181  YLKNIWKVMNWKYASEVYAKECPSS 205
            YLKNIWKVMNWKYASEVYAKECPSS
Sbjct  209  YLKNIWKVMNWKYASEVYAKECPSS 233

Sequence Alignment: 3. Allergen Name: Hev b 10.0103 Sequence ID: CAC13961

 Score = 322.8 bits 1386,  Expect = 5e-90
 Identities = 203/205 99%, Positives = 204/205 99%, Gaps = 0/205 0%
Query  1    QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 60
            QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK
Sbjct  1    QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 60
Query  61   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGV 120
            LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEG 
Sbjct  61   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGA 120
Query  121  ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD 180
            AL+GSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD
Sbjct  121  ALRGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD 180
Query  181  YLKNIWKVMNWKYASEVYAKECPSS 205
            YLKNIWKVMNWKYASEVYAKECPSS
Sbjct  181  YLKNIWKVMNWKYASEVYAKECPSS 205

Sequence Alignment: 4. Allergen Name: Pis v 4.0101 Sequence ID: EF470980

 Score = 292.0 bits 1251,  Expect = 1e-80
 Identities = 178/203 87%, Positives = 189/203 93%, Gaps = 0/203 0%
Query  1    QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 60
            QTF+LPDLPY+YGALEPAIS EIMQLHHQKHHQTYITNYNKALEQL+ AI KGD++AVVK
Sbjct  28   QTFTLPDLPYEYGALEPAISSEIMQLHHQKHHQTYITNYNKALEQLDQAINKGDASAVVK 87
Query  61   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGV 120
            LQSAIKFNGGGH+NHSIFWKNL PV EGGGE PHGSLGWAID +FGS+E LIQ MNAEG 
Sbjct  88   LQSAIKFNGGGHINHSIFWKNLTPVSEGGGEPPHGSLGWAIDTNFGSMEALIQRMNAEGA 147
Query  121  ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD 180
            ALQGSGWVWL LDKE KKLVVETTANQDPLVTKGP+LVPLLGIDVWEHAYYLQYKNVRPD
Sbjct  148  ALQGSGWVWLGLDKESKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPD 207
Query  181  YLKNIWKVMNWKYASEVYAKECP 203
            YLKNIWKV+NWKYA E+Y KECP
Sbjct  208  YLKNIWKVINWKYAGELYQKECP 230

Sequence Alignment: 5. Allergen Name: Asp f 6 Sequence ID: Q92450

 Score = 159.6 bits 670,  Expect = 6e-41
 Identities = 98/194 50%, Positives = 129/194 66%, Gaps = 5/194 2%
Query  1    QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 60
            Q ++LP LPY Y AL+P IS +IM+LHH+KHHQTY+   N ALE    A E  D   +V 
Sbjct  3    QQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLVS 62
Query  61   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGS-LGWAIDADFGSLEKLIQLMNAEG 119
            +Q AIKFNGGGH+NHS+FWKNLAP + GGG++ +   L  AI+  +GS++K+    N   
Sbjct  63   VQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTL 122
Query  120  VALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRP 179
            + +QGSGW WL  D    KL + TT +QDP+    P    ++G+D+WEHAYYLQY N + 
Sbjct  123  LGIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAP----VFGVDMWEHAYYLQYLNDKA 178
Query  180  DYLKNIWKVMNWKYASEVY 198
             Y K IW V+NW  A   Y
Sbjct  179  SYAKGIWNVINWAEAENRY 197

Sequence Alignment: 6. Allergen Name: Asp f 6 Sequence ID: AAB60779

 Score = 159.5 bits 670,  Expect = 7e-41
 Identities = 98/194 50%, Positives = 129/194 66%, Gaps = 5/194 2%
Query  1    QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK 60
            Q ++LP LPY Y AL+P IS +IM+LHH+KHHQTY+   N ALE    A E  D   +V 
Sbjct  14   QQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLVS 73
Query  61   LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGS-LGWAIDADFGSLEKLIQLMNAEG 119
            +Q AIKFNGGGH+NHS+FWKNLAP + GGG++ +   L  AI+  +GS++K+    N   
Sbjct  74   VQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTL 133
Query  120  VALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRP 179
            + +QGSGW WL  D    KL + TT +QDP+    P    ++G+D+WEHAYYLQY N + 
Sbjct  134  LGIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAP----VFGVDMWEHAYYLQYLNDKA 189
Query  180  DYLKNIWKVMNWKYASEVY 198
             Y K IW V+NW  A   Y
Sbjct  190  SYAKGIWNVINWAEAENRY 208

Sequence Alignment: 7. Allergen Name: Mala s 11 Sequence ID: CAD68071

 Score = 156.8 bits 658,  Expect = 5e-40
 Identities = 95/192 49%, Positives = 128/192 66%, Gaps = 5/192 2%
Query  4    SLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVKLQS 63
            +LP LPY+Y ALEP IS +IM +HH KHHQTY+ N N + +  NDA++  D    ++L +
Sbjct  40   TLPPLPYEYNALEPFISADIMMVHHGKHHQTYVNNLNASTKAYNDAVQAQDVLKQMELLT 99
Query  64   AIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGVALQ 123
            A+KFNGGGHVNH++FWK +AP  +GGG+L  G L  AID +FG +EK+     A+ + +Q
Sbjct  100  AVKFNGGGHVNHALFWKTMAPQSQGGGQLNDGPLKQAIDKEFGDFEKFKAAFTAKALGIQ 159
Query  124  GSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLK 183
            GSGW WL L K    L +    +QD L T  P    ++G D WEHA+YLQYKN +  YLK
Sbjct  160  GSGWCWLGLSKT-GSLDLVVAKDQDTLTTHHP----IIGWDGWEHAWYLQYKNDKASYLK 214
Query  184  NIWKVMNWKYASEVYAK 200
              W V+NW  A   Y++
Sbjct  215  QWWNVVNWSEAESRYSE 231

Sequence Alignment: 8. Allergen Name: Alt a 14.0101 Sequence ID: P86254

 Score = 38.3 bits 121,  Expect = 2e-05
 Identities = 14/18 77%, Positives = 17/18 94%, Gaps = 0/18 0%
Query  67   FNGGGHVNHSIFWKNLAP 84
            FN GGH+NHS+FW+NLAP
Sbjct  1    FNAGGHINHSLFWQNLAP 18

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.