The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG
HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA07772 Ory s TAI 111 825 131.4 5.6e-33
BAA07710 Ory s TAI 166 754 121.2 1e-29
BAA07773 Ory s TAI 109 708 114.3 8e-28
BAA02000 Ory s TAI 166 707 114.3 1.2e-27
BAA01998 Ory s TAI 165 697 112.8 3.3e-27
BAA07711 Ory s TAI 160 695 112.5 3.9e-27
BAA07774 Ory s TAI 113 686 111.0 7.6e-27
BAA01997 Ory s TAI 162 637 104.0 1.4e-24
BAA07713 Ory s TAI 160 562 93.0 2.9e-21
BAA01996 Ory s TAI 157 552 91.5 7.9e-21
BAA07712 Ory s TAI 157 510 85.4 5.6e-19
AAB99797 Ory s TAI 157 420 72.2 5.2e-15
P16968 Hor v 1 146 357 62.9 3e-12
P16968 Hor v 15.0101 146 357 62.9 3e-12
CBA13560 Tri a 15.0101 121 293 53.5 1.7e-09
P01083 Tri a TAI 123 291 53.2 2.1e-09
CAA08836 Hor v 1 152 281 51.8 6.9e-09
CAI84642 Tri a 28.0101 119 198 39.6 2.7e-05
P01085 Tri a TAI 124 198 39.6 2.7e-05
BAA01999 Ory s TAI 95 193 38.7 3.7e-05
P01084 Tri a TAI 124 185 37.7 0.0001
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 131.4 bits 825,  Expect = 6e-33
 Identities = 111/111 100%, Positives = 111/111 100%, Gaps = 0/111 0%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111
            HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 121.2 bits 754,  Expect = 1e-29
 Identities = 103/111 92%, Positives = 103/111 92%, Gaps = 0/111 0%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  VKRQCVAT HPAA G EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG
Sbjct  56   RAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 115
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111
            HPMAEVFPGCRRGDLER   SLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  116  HPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 114.3 bits 708,  Expect = 8e-28
 Identities = 97/107 90%, Positives = 98/107 91%, Gaps = 1/107 0%
Query  4    VKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 63
            VKRQCVAT        EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM
Sbjct  3    VKRQCVATRRTGG-ADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
Query  64   AEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111
            AEVFPGCRRGDLER R +LPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  62   AEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 114.3 bits 707,  Expect = 1e-27
 Identities = 97/111 87%, Positives = 97/111 87%, Gaps = 0/111 0%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  VKRQCV    P     EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG
Sbjct  56   RAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 115
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111
            HPMAEVFPGCRRGDLER   SLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  116  HPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 112.8 bits 697,  Expect = 3e-27
 Identities = 97/110 88%, Positives = 98/110 89%, Gaps = 1/110 0%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  VKRQCV T  P A   EQL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVG
Sbjct  56   RAVVKRQCVGTRSPGAVD-EQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVG 114
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111
            HPMAEVFPGCRRGDLER   SLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  115  HPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 112.5 bits 695,  Expect = 4e-27
 Identities = 97/111 87%, Positives = 97/111 87%, Gaps = 1/111 0%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  VKRQCV    P     EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG
Sbjct  49   RAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 108
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 111
            HPMAEVFPGCRRGDLER   SLPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  109  HPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 111.0 bits 686,  Expect = 8e-27
 Identities = 93/107 86%, Positives = 95/107 88%, Gaps = 0/107 0%
Query  5    KRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 64
            +RQCV         T+QLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA
Sbjct  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
Query  65   EVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111
            EVFPGCRRGDLER   SLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 104.0 bits 637,  Expect = 1e-24
 Identities = 87/109 79%, Positives = 92/109 84%, Gaps = 2/109 1%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  V+RQCV     AA   EQ+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ G
Sbjct  54   RTLVRRQCVGRGASAA--DEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAG 111
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111
            HPMAEVFPGCRRGDLER   SLPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  112  HPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 93.0 bits 562,  Expect = 3e-21
 Identities = 78/99 78%, Positives = 84/99 84%, Gaps = 2/99 2%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  VKRQCV     AA   EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVG
Sbjct  57   RALVKRQCVGRGTAAA--AEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVG 114
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWL 101
            HPM+EVF GCRRGDLER   SLPAFCNVDIPNG GGVCYWL
Sbjct  115  HPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 91.5 bits 552,  Expect = 8e-21
 Identities = 76/97 78%, Positives = 83/97 85%, Gaps = 4/97 4%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  VKRQC      +A   EQ+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVG
Sbjct  56   RALVKRQC----RGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVG 111
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWL 101
            HPM+EVF GCRRGDLER   SLPAFCNVDIPNG GGVCYWL
Sbjct  112  HPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 85.4 bits 510,  Expect = 6e-19
 Identities = 76/100 76%, Positives = 82/100 82%, Gaps = 13/100 13%
Query  1    RHEVKRQCVATTHPAAPGT--EQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATD 58
            R  VKRQCVA      PGT  EQ+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D
Sbjct  56   RAFVKRQCVA------PGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAAD 109
Query  59   VGHPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111
             GHPMAEVF GCRRGD+ER   SLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  110  AGHPMAEVFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 72.2 bits 420,  Expect = 5e-15
 Identities = 57/86 66%, Positives = 64/86 74%, Gaps = 1/86 1%
Query  15   AAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGD 74
            A P    +  DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+EVF GCRRG 
Sbjct  67   ARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGT 126
Query  75   LERRRRSLPAFCNVDIPNGTGGVCYWL 101
               RRR+ P    VDIPNG GGVCYWL
Sbjct  127  WSARRRA-PGVLQVDIPNGGGGVCYWL 152

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 62.9 bits 357,  Expect = 3e-12
 Identities = 55/103 53%, Positives = 66/103 64%, Gaps = 9/103 8%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGAT--D 58
            R  VK QC           E +++DCCRQ+AA+ D WC C AL  M G +Y+ELG    D
Sbjct  35   RALVKSQCAG-----GQVVESIQKDCCRQIAAIGDEWCICGALGSMRGSMYKELGVALAD 89
Query  59   VGHPMAEVFPGCRRGDLERRRRSLPAFCNVDIPN--GTGGVCYWLGYPRTPR 108
                +AEVFPGCR   ++R   SLPA CN  IPN  GT GVCYWL Y + PR
Sbjct  90   DKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVCYWLSYYQPPR 141

Sequence Alignment: 14. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 62.9 bits 357,  Expect = 3e-12
 Identities = 55/103 53%, Positives = 66/103 64%, Gaps = 9/103 8%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGAT--D 58
            R  VK QC           E +++DCCRQ+AA+ D WC C AL  M G +Y+ELG    D
Sbjct  35   RALVKSQCAG-----GQVVESIQKDCCRQIAAIGDEWCICGALGSMRGSMYKELGVALAD 89
Query  59   VGHPMAEVFPGCRRGDLERRRRSLPAFCNVDIPN--GTGGVCYWLGYPRTPR 108
                +AEVFPGCR   ++R   SLPA CN  IPN  GT GVCYWL Y + PR
Sbjct  90   DKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVCYWLSYYQPPR 141

Sequence Alignment: 15. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 53.5 bits 293,  Expect = 2e-09
 Identities = 47/95 49%, Positives = 64/95 67%, Gaps = 12/95 12%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  VK QCV +  P     E + +DCC+QLA V++ WCRC  L+ M+  +Y+ELGA + G
Sbjct  22   RAMVKLQCVGSQVP-----EAVLRDCCQQLADVNNEWCRCEDLSSMLRSVYQELGARE-G 75
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTG---GVCYWLGYP 104
                EV+PGCR+  ++    S+P    V IPN +G   GVCYW  YP
Sbjct  76   K---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWAAYP 119

Sequence Alignment: 16. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 53.2 bits 291,  Expect = 2e-09
 Identities = 46/95 48%, Positives = 64/95 67%, Gaps = 14/95 14%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  VK QCV +  P     E + +DCC+QLA +++ WCRC  L+ M+  +Y+ELG  + G
Sbjct  22   RAMVKLQCVGSQVP-----EAVLRDCCQQLADINNEWCRCGDLSSMLRSVYQELGVRE-G 75
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTG---GVCY--WLGYP 104
                EV+PGCR+  ++    S+P  C V IPN +G   GVCY  W  YP
Sbjct  76   K---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAYP 121

Sequence Alignment: 17. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 51.8 bits 281,  Expect = 7e-09
 Identities = 43/92 46%, Positives = 59/92 64%, Gaps = 11/92 11%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  VK +CV    P     E + +DCC+++A + + WCRC  L  M+  +Y  LG   VG
Sbjct  52   RALVKLECVGNRVP-----EDVLRDCCQEVANISNEWCRCGDLGSMLRSVYAALG---VG 103
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDIPN---GTGGVCYW 100
                EVFPGC++  ++     +PA+CNV IPN   GT GVCYW
Sbjct  104  GGPEEVFPGCQKDVMKLLVAGVPALCNVPIPNEAAGTRGVCYW 146

Sequence Alignment: 18. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 39.6 bits 198,  Expect = 3e-05
 Identities = 36/91 39%, Positives = 54/91 59%, Gaps = 11/91 12%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  ++ QC  +  P     E + +DCC+QLA + + WCRC AL  M+  +Y+E GA + G
Sbjct  16   RPLLRLQCNGSQVP-----EAVLRDCCQQLAHISE-WCRCGALYSMLDSMYKEHGAQE-G 68
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDI---PNGTGG-VC 98
            +     FP CRR  ++    S+ A C + I    +G G  VC
Sbjct  69   QAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 19. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 39.6 bits 198,  Expect = 3e-05
 Identities = 36/91 39%, Positives = 54/91 59%, Gaps = 11/91 12%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  ++ QC  +  P     E + +DCC+QLA + + WCRC AL  M+  +Y+E GA + G
Sbjct  21   RPLLRLQCNGSQVP-----EAVLRDCCQQLAHISE-WCRCGALYSMLDSMYKEHGAQE-G 73
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDI---PNGTGG-VC 98
            +     FP CRR  ++    S+ A C + I    +G G  VC
Sbjct  74   QAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 20. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 38.7 bits 193,  Expect = 4e-05
 Identities = 28/42 66%, Positives = 31/42 73%, Gaps = 2/42 4%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALN 44
            R  V+RQCV     AA   EQ+ QDCCRQLAAVDD WCRC AL+
Sbjct  54   RTLVRRQCVGRGASAAD--EQVWQDCCRQLAAVDDGWCRCGALD 95

Sequence Alignment: 21. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 37.7 bits 185,  Expect = 0.0001
 Identities = 35/91 38%, Positives = 53/91 58%, Gaps = 11/91 12%
Query  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
            R  +K QC  +  P     E + +DCC+QLA + + W RC AL  M+  +Y+E G ++ G
Sbjct  21   RPLLKLQCNGSQVP-----EAVLRDCCQQLADISE-WPRCGALYSMLDSMYKEHGVSE-G 73
Query  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDI---PNGTGG-VC 98
            +     FP CRR  ++    S+ A C + I    +G G  VC
Sbjct  74   QAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.