The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR
EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
VIM
Sequence Info Allergen Name Length Opt Bits Score E Value
2428875 Der f 1.0104 303 2040 471.5 1.7e-134
BAC53948 Der f 1.0101 321 2023 467.6 2.6e-133
ABL84749 Der f 1.0108 321 2018 466.5 5.8e-133
ABL84750 Der f 1.0109 321 2018 466.5 5.8e-133
2428875 Der f 1.0107 303 2017 466.3 6.4e-133
ABL84751 Der f 1.0110 321 2017 466.3 6.8e-133
2428875 Der f 1.0105 303 2014 465.6 1e-132
2428875 Der f 1.0103 303 2014 465.6 1e-132
2428875 Der f 1.0102 303 2013 465.4 1.2e-132
P16311 Der f 1 321 2008 464.2 2.8e-132
P25780 Eur m 1.0101 321 1786 413.6 4.9e-117
AAC82351 Eur m 1.0101 321 1786 413.6 4.9e-117
AAC82352 Eur m 1.0102 321 1781 412.5 1.1e-116
P08176 Der p 1 320 1722 399.0 1.2e-112
ABA39435 Der p 1.0113 302 1711 396.6 6.3e-112
CAQ68250 Der p 1.0124 302 1708 395.9 1e-111
CAA46316 Der f 1 212 1450 337.2 3.2e-94
6771329 Der p 1.0117 222 1283 299.1 9.9e-83
6771329 Der p 1.0115 222 1279 298.2 1.9e-82
6771329 Der p 1.0118 222 1277 297.8 2.5e-82
6771329 Der p 1.0119 222 1274 297.1 4.1e-82
6771329 Der p 1.0123 222 1274 297.1 4.1e-82
6771329 Der p 1.0121 222 1273 296.8 4.8e-82
6771329 Der p 1.0122 222 1272 296.6 5.6e-82
6771329 Der p 1.0116 222 1272 296.6 5.6e-82
6771329 Der p 1.0120 222 1272 296.6 5.6e-82
6771329 Der p 1.0114 222 1271 296.4 6.6e-82
CAA42677 Eur m 1.0101 211 1261 294.1 3e-81
AAA28296 Der p 1 96 552 133.4 3.2e-33
P14080 Cari p 2.0101 352 507 122.1 3.1e-29
AAK58415 Blo t 1.0101 221 499 120.4 6.2e-29
AAQ24541 Blo t 1.0201 333 493 118.9 2.7e-28
P00785 Act d 1 380 492 118.6 3.7e-28
AAA32629 Act d 1 380 488 117.7 6.9e-28
BAA21849 Ana c 2 351 479 115.7 2.6e-27
V5LU01 Amb a 11.0101 386 460 111.3 5.9e-26
AAB09252 Gly m 1 379 428 104.0 9e-24
P22895 Gly m 1 379 427 103.8 1.1e-23
AAB02650 Car p papain 345 425 103.4 1.3e-23
ABM53753 Tyr p 1.0101 336 249 63.3 1.5e-11
P16312 Der m 1 30 172 50.1 1.2e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 1.0104 Sequence ID: 2428875

 Score = 471.5 bits 2040,  Expect = 2e-134
 Identities = 303/303 100%, Positives = 303/303 100%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
Query  301  VIM 303
            VIM
Sbjct  301  VIM 303

Sequence Alignment: 2. Allergen Name: Der f 1.0101 Sequence ID: BAC53948

 Score = 467.6 bits 2023,  Expect = 3e-133
 Identities = 301/303 99%, Positives = 301/303 99%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            YLMSAEAFEQLKTQFDLNAE SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRNTSLDLSEQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  259  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
Query  301  VIM 303
            VIM
Sbjct  319  VIM 321

Sequence Alignment: 3. Allergen Name: Der f 1.0108 Sequence ID: ABL84749

 Score = 466.5 bits 2018,  Expect = 6e-133
 Identities = 300/303 99%, Positives = 300/303 99%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            YLMSAEAFEQLKTQFDLNAE SACRINSVNVPSELDLRSLRT TPIRMQGGCGSCWAFSG
Sbjct  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTATPIRMQGGCGSCWAFSG 138
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRNTSLDLSEQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  259  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
Query  301  VIM 303
            VIM
Sbjct  319  VIM 321

Sequence Alignment: 4. Allergen Name: Der f 1.0109 Sequence ID: ABL84750

 Score = 466.5 bits 2018,  Expect = 6e-133
 Identities = 300/303 99%, Positives = 301/303 99%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            YLMSAEAFEQLKTQFDLNAE SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRNTSLDLSEQ+LVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  139  VAATESAYLAYRNTSLDLSEQKLVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  259  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
Query  301  VIM 303
            VIM
Sbjct  319  VIM 321

Sequence Alignment: 5. Allergen Name: Der f 1.0107 Sequence ID: 2428875

 Score = 466.3 bits 2017,  Expect = 6e-133
 Identities = 300/303 99%, Positives = 301/303 99%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            YLMSAEAFEQLKTQFDLNAE SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  61   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRNTSLDLSEQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQ+CRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  181  EQRCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
Query  301  VIM 303
            VIM
Sbjct  301  VIM 303

Sequence Alignment: 6. Allergen Name: Der f 1.0110 Sequence ID: ABL84751

 Score = 466.3 bits 2017,  Expect = 7e-133
 Identities = 300/303 99%, Positives = 301/303 99%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            YLMSAEAFEQLKTQFDLNAE SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRNTSLDLSEQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  199  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            +HDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  259  RHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
Query  301  VIM 303
            VIM
Sbjct  319  VIM 321

Sequence Alignment: 7. Allergen Name: Der f 1.0105 Sequence ID: 2428875

 Score = 465.6 bits 2014,  Expect = 1e-132
 Identities = 300/303 99%, Positives = 300/303 99%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            YLMSAEAFEQLKTQFDLNAE SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  61   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRNTSLDLSEQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQQCRRPNSQHY ISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  181  EQQCRRPNSQHYDISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
Query  301  VIM 303
            VIM
Sbjct  301  VIM 303

Sequence Alignment: 8. Allergen Name: Der f 1.0103 Sequence ID: 2428875

 Score = 465.6 bits 2014,  Expect = 1e-132
 Identities = 300/303 99%, Positives = 300/303 99%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            YLMSAEAFEQLKTQFDLNAE SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  61   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRNTSLDLSEQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHY GRTII
Sbjct  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYGGRTII 240
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
Query  301  VIM 303
            VIM
Sbjct  301  VIM 303

Sequence Alignment: 9. Allergen Name: Der f 1.0102 Sequence ID: 2428875

 Score = 465.4 bits 2013,  Expect = 1e-132
 Identities = 300/303 99%, Positives = 300/303 99%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            YLMSAEAFEQLKTQFDLNAE SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  61   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRNTSLDLSEQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            Q DNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  241  QRDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
Query  301  VIM 303
            VIM
Sbjct  301  VIM 303

Sequence Alignment: 10. Allergen Name: Der f 1 Sequence ID: P16311

 Score = 464.2 bits 2008,  Expect = 3e-132
 Identities = 299/303 98%, Positives = 300/303 99%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR
Sbjct  19   RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 78
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            YLMSAEAFEQLKTQFDLNAE SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  79   YLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRNTSLDLSEQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAR
Sbjct  139  VAATESAYLAYRNTSLDLSEQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAR 198
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQ+CRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII
Sbjct  199  EQRCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 258
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYGSTQG DYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV
Sbjct  259  QHDNGYQPNYHAVNIVGYGSTQGDDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 318
Query  301  VIM 303
            VIM
Sbjct  319  VIM 321

Sequence Alignment: 11. Allergen Name: Eur m 1.0101 Sequence ID: P25780

 Score = 413.6 bits 1786,  Expect = 5e-117
 Identities = 260/303 85%, Positives = 282/303 93%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNK YAT E+EEVARKNFLESLKYVE+NKGAINHLSDLSLDEFKN+
Sbjct  19   RPASIKTFEEFKKAFNKTYATPEKEEVARKNFLESLKYVESNKGAINHLSDLSLDEFKNQ 78
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            +LM+A AFEQLKTQFDLNAE  AC INSV++PSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  79   FLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VA+TESAYLAYRN SLDL+EQELVDCASQ+G HGDTIPRGIEYIQQNGVV+E  YPYVAR
Sbjct  139  VASTESAYLAYRNMSLDLAEQELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAR 198
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQ C RPN+Q YG+ NYCQI PPD  +IR+ALTQTHTA+AVIIGIKDL AF+HYDGRTI+
Sbjct  199  EQSCHRPNAQRYGLKNYCQISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIM 258
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYG+TQGVDYWIVRNSWDTTWGD+GYGYF A  NLMMIEQYPYV
Sbjct  259  QHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYV 318
Query  301  VIM 303
            V++
Sbjct  319  VML 321

Sequence Alignment: 12. Allergen Name: Eur m 1.0101 Sequence ID: AAC82351

 Score = 413.6 bits 1786,  Expect = 5e-117
 Identities = 260/303 85%, Positives = 282/303 93%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNK YAT E+EEVARKNFLESLKYVE+NKGAINHLSDLSLDEFKN+
Sbjct  19   RPASIKTFEEFKKAFNKTYATPEKEEVARKNFLESLKYVESNKGAINHLSDLSLDEFKNQ 78
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            +LM+A AFEQLKTQFDLNAE  AC INSV++PSELDLRSLRTVTPIRMQGGCGSCWAFSG
Sbjct  79   FLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSG 138
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VA+TESAYLAYRN SLDL+EQELVDCASQ+G HGDTIPRGIEYIQQNGVV+E  YPYVAR
Sbjct  139  VASTESAYLAYRNMSLDLAEQELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAR 198
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQ C RPN+Q YG+ NYCQI PPD  +IR+ALTQTHTA+AVIIGIKDL AF+HYDGRTI+
Sbjct  199  EQSCHRPNAQRYGLKNYCQISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIM 258
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYG+TQGVDYWIVRNSWDTTWGD+GYGYF A  NLMMIEQYPYV
Sbjct  259  QHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYV 318
Query  301  VIM 303
            V++
Sbjct  319  VML 321

Sequence Alignment: 13. Allergen Name: Eur m 1.0102 Sequence ID: AAC82352

 Score = 412.5 bits 1781,  Expect = 1e-116
 Identities = 260/303 85%, Positives = 282/303 93%, Gaps = 0/303 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RPASIKTFEEFKKAFNK+YAT E+EEVARKNFLESLKYVE+NKGAINHLSDLSLDEFKN+
Sbjct  19   RPASIKTFEEFKKAFNKSYATPEKEEVARKNFLESLKYVESNKGAINHLSDLSLDEFKNQ 78
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            +LM+A AFEQLKTQFDLNAE  AC INSV++PSELDLRSLRTVTPIR QGGCGSCWAFSG
Sbjct  79   FLMNANAFEQLKTQFDLNAETYACSINSVSLPSELDLRSLRTVTPIRNQGGCGSCWAFSG 138
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VA+TESAYLAYRN SLDL+EQELVDCASQ+G HGDTIPRGIEYIQQNGVV+E  YPYVAR
Sbjct  139  VASTESAYLAYRNMSLDLAEQELVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAR 198
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQ C RPN+Q YG+ NYCQI PPD  +IR+ALTQTHTA+AVIIGIKDL AF+HYDGRTI+
Sbjct  199  EQSCHRPNAQRYGLKNYCQISPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIM 258
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            QHDNGYQPNYHAVNIVGYG+TQGVDYWIVRNSWDTTWGD+GYGYF A  NLMMIEQYPYV
Sbjct  259  QHDNGYQPNYHAVNIVGYGNTQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYV 318
Query  301  VIM 303
            VI+
Sbjct  319  VIL 321

Sequence Alignment: 14. Allergen Name: Der p 1 Sequence ID: P08176

 Score = 399.0 bits 1722,  Expect = 1e-112
 Identities = 250/302 82%, Positives = 277/302 91%, Gaps = 1/302 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RP+SIKTFEE+KKAFNK+YAT E+EE ARKNFLES+KYV++N GAINHLSDLSLDEFKNR
Sbjct  19   RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFKNR 78
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            +LMSAEAFE+LKTQFDLNAE +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSG
Sbjct  79   FLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSG 137
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRN SLDL+EQELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAR
Sbjct  138  VAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAR 197
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQ CRRPN+Q +GISNYCQIYPP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII
Sbjct  198  EQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTII 257
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            Q DNGYQPNYHAVNIVGY + QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYV
Sbjct  258  QRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV 317
Query  301  VIM 303
            VI+
Sbjct  318  VIL 320

Sequence Alignment: 15. Allergen Name: Der p 1.0113 Sequence ID: ABA39435

 Score = 396.6 bits 1711,  Expect = 6e-112
 Identities = 248/302 82%, Positives = 275/302 91%, Gaps = 1/302 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RP+SIK FEE+KKAFNK+YAT E+EE ARKNFLES+KYV++N GAINHLSDLSLDEFKNR
Sbjct  1    RPSSIKPFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFKNR 60
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            +LMSAEAFE+LKTQFDLNAE +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSG
Sbjct  61   FLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSG 119
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRN SLDL+EQELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAR
Sbjct  120  VAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAR 179
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQ CRRPN+Q +GISNYCQIYPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII
Sbjct  180  EQSCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTII 239
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            Q DNGYQPNYHAVNIVGY + QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYV
Sbjct  240  QRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV 299
Query  301  VIM 303
            VI+
Sbjct  300  VIL 302

Sequence Alignment: 16. Allergen Name: Der p 1.0124 Sequence ID: CAQ68250

 Score = 395.9 bits 1708,  Expect = 1e-111
 Identities = 248/302 82%, Positives = 276/302 91%, Gaps = 1/302 0%
Query  1    RPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNR 60
            RP+SIKTFEE+KKAFNK+YAT E+EE ARKNFLES+KYV++N GAINHLSDLSLDEFKNR
Sbjct  1    RPSSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFKNR 60
Query  61   YLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSG 120
            +LMSAEAFE+LKTQFDLNAE +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSG
Sbjct  61   FLMSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSG 119
Query  121  VAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAR 180
            VAATESAYLAYRN SLDL+EQELVDCASQHG +GDTIPRGIEYIQ+NGVV+E  Y YVAR
Sbjct  120  VAATESAYLAYRNQSLDLAEQELVDCASQHGCNGDTIPRGIEYIQHNGVVQESYYRYVAR 179
Query  181  EQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTII 240
            EQ CRRPN+Q +GISNYCQIYPP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII
Sbjct  180  EQSCRRPNAQRFGISNYCQIYPPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTII 239
Query  241  QHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYV 300
            Q DNGYQPNYHAVNIVGY + QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYV
Sbjct  240  QRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYV 299
Query  301  VIM 303
            VI+
Sbjct  300  VIL 302

Sequence Alignment: 17. Allergen Name: Der f 1 Sequence ID: CAA46316

 Score = 337.2 bits 1450,  Expect = 3e-94
 Identities = 210/212 99%, Positives = 210/212 99%, Gaps = 0/212 0%
Query  80   EISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 139
            E SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS
Sbjct  1    ETSACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLS 60
Query  140  EQELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 199
            EQELVDCASQHG HGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ
Sbjct  61   EQELVDCASQHGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQ 120
Query  200  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 259
            IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG
Sbjct  121  IYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYG 180
Query  260  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 291
            STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL
Sbjct  181  STQGVDYWIVRNSWDTTWGDSGYGYFQAGNNL 212

Sequence Alignment: 18. Allergen Name: Der p 1.0117 Sequence ID: 6771329

 Score = 299.1 bits 1283,  Expect = 1e-82
 Identities = 182/221 82%, Positives = 200/221 90%, Gaps = 1/221 0%
Query  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
            +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+EQ
Sbjct  2    NACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
            ELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
            PP+  +IREALTQTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY + 
Sbjct  121  PPNANKIREALTQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 19. Allergen Name: Der p 1.0115 Sequence ID: 6771329

 Score = 298.2 bits 1279,  Expect = 2e-82
 Identities = 181/221 81%, Positives = 199/221 90%, Gaps = 1/221 0%
Query  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
            +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+EQ
Sbjct  2    NACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
            ELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNTQRFGISNYCQIY 120
Query  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
            PP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY + 
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 20. Allergen Name: Der p 1.0118 Sequence ID: 6771329

 Score = 297.8 bits 1277,  Expect = 3e-82
 Identities = 181/221 81%, Positives = 199/221 90%, Gaps = 1/221 0%
Query  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
            +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+EQ
Sbjct  2    NACSING-NAPAEIDLRQIRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
            ELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
            PP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY + 
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 21. Allergen Name: Der p 1.0119 Sequence ID: 6771329

 Score = 297.1 bits 1274,  Expect = 4e-82
 Identities = 181/221 81%, Positives = 199/221 90%, Gaps = 1/221 0%
Query  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
            +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+EQ
Sbjct  2    NACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
            ELVDCASQHG HGDTIPRGI YIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIGYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
            PP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY + 
Sbjct  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 22. Allergen Name: Der p 1.0123 Sequence ID: 6771329

 Score = 297.1 bits 1274,  Expect = 4e-82
 Identities = 181/221 81%, Positives = 198/221 89%, Gaps = 1/221 0%
Query  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
            +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+EQ
Sbjct  2    NACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
            ELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
            PP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY + 
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222

Sequence Alignment: 23. Allergen Name: Der p 1.0121 Sequence ID: 6771329

 Score = 296.8 bits 1273,  Expect = 5e-82
 Identities = 181/221 81%, Positives = 199/221 90%, Gaps = 1/221 0%
Query  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
            +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYR+ SLDL+EQ
Sbjct  2    NACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQ 60
Query  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
            ELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
            PP+V +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY + 
Sbjct  121  PPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE YPYVVI+
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYPYVVIL 222

Sequence Alignment: 24. Allergen Name: Der p 1.0122 Sequence ID: 6771329

 Score = 296.6 bits 1272,  Expect = 6e-82
 Identities = 180/221 81%, Positives = 198/221 89%, Gaps = 1/221 0%
Query  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
            +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+EQ
Sbjct  2    NACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
            ELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +G SNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGTSNYCQIY 120
Query  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
            PP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY + 
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 25. Allergen Name: Der p 1.0116 Sequence ID: 6771329

 Score = 296.6 bits 1272,  Expect = 6e-82
 Identities = 181/221 81%, Positives = 199/221 90%, Gaps = 1/221 0%
Query  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
            +AC IN  N P+E+DLR LRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+EQ
Sbjct  2    NACSING-NAPAEIDLRQLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
            ELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
            PP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNY+AVNIVGY + 
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYYAVNIVGYSNA 180
Query  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 26. Allergen Name: Der p 1.0120 Sequence ID: 6771329

 Score = 296.6 bits 1272,  Expect = 6e-82
 Identities = 180/221 81%, Positives = 199/221 90%, Gaps = 1/221 0%
Query  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
            +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+EQ
Sbjct  2    NACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
            ELVDCASQHG HGDTIPRGIEYIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
            PP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTII+ DNGYQPNYHAVNIVGY + 
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIRRDNGYQPNYHAVNIVGYSNA 180
Query  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 27. Allergen Name: Der p 1.0114 Sequence ID: 6771329

 Score = 296.4 bits 1271,  Expect = 7e-82
 Identities = 180/221 81%, Positives = 198/221 89%, Gaps = 1/221 0%
Query  82   SACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQ 141
            +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVAATESAYLAYRN SLDL+EQ
Sbjct  2    NACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQ 60
Query  142  ELVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIY 201
            ELVDCASQHG HGDTIPRGI YIQ+NGVV+E  Y YVAREQ CRRPN+Q +GISNYCQIY
Sbjct  61   ELVDCASQHGCHGDTIPRGIAYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIY 120
Query  202  PPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGST 261
            PP+  +IREAL QTH+AIAVIIGIKDL AF+HYDGRTIIQ DNGYQPNYHAVNIVGY + 
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNA 180
Query  262  QGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYPYVVIM 303
            QGVDYWIVRNSWDT WGD+GYGYF A  +LMMIE+YPYVVI+
Sbjct  181  QGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL 222

Sequence Alignment: 28. Allergen Name: Eur m 1.0101 Sequence ID: CAA42677

 Score = 294.1 bits 1261,  Expect = 3e-81
 Identities = 178/209 85%, Positives = 193/209 92%, Gaps = 0/209 0%
Query  83   ACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQE 142
            AC INSV++PSELDLRSLRTVTPIRMQGGCGSCWAFSGVA+TESAYLAYRN SLDL+EQE
Sbjct  3    ACSINSVSLPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQE 62
Query  143  LVDCASQHGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYP 202
            LVDCASQ+G HGDTIPRGIEYIQQNGVV+E  YPYVAREQ C RPN+Q YG+ NYCQI P
Sbjct  63   LVDCASQNGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQRYGLKNYCQISP 122
Query  203  PDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQ 262
            PD  +IR+ALTQTHTA+AVIIGIKDL AF+HYDGRTI+QHDNGYQPNYHAVNIVGYG+TQ
Sbjct  123  PDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNYHAVNIVGYGNTQ 182
Query  263  GVDYWIVRNSWDTTWGDSGYGYFQAGNNL 291
            GVDYWIVRNSWDTTWGD+GYGYF A  NL
Sbjct  183  GVDYWIVRNSWDTTWGDNGYGYFAANINL 211

Sequence Alignment: 29. Allergen Name: Der p 1 Sequence ID: AAA28296

 Score = 133.4 bits 552,  Expect = 3e-33
 Identities = 82/96 85%, Positives = 89/96 92%, Gaps = 1/96 1%
Query  63   MSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFSGVA 122
            MSAEAFE+LKTQFDLNAE +AC IN  N P+E+DLR +RTVTPIRMQGGCGSCWAFSGVA
Sbjct  1    MSAEAFEHLKTQFDLNAETNACSING-NAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVA 59
Query  123  ATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPR 159
            ATESAYLA+RN SLDL+EQELVDCASQHG HGDTIPR
Sbjct  60   ATESAYLAHRNQSLDLAEQELVDCASQHGCHGDTIPR 96

Sequence Alignment: 30. Allergen Name: Cari p 2.0101 Sequence ID: P14080

 Score = 122.1 bits 507,  Expect = 3e-29
 Identities = 101/273 36%, Positives = 161/273 58%, Gaps = 30/273 10%
Query  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 57
            I+ F+ +    NK Y +++E+    + F ++L Y+ E NK        +N ++DLS DEF
Sbjct  45   IQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDETNKKNNSYWLGLNGFADLSNDEF 104
Query  58   KNRYL-MSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCW 116
            K +Y+   AE F  L+ +FD N + +   +   N P  +D R+   VTP++ QG CGSCW
Sbjct  105  KKKYVGFVAEDFTGLE-HFD-NEDFTYKHV--TNYPQSIDWRAKGAVTPVKNQGACGSCW 160
Query  117  AFSGVAATESAYLAYRNTSLDLSEQELVDCASQ-HGRHGDTIPRGIEYIQQNGVVEERSY 175
            AFS +A  E          L+LSEQELVDC  + +G  G      ++Y+  NGV   + Y
Sbjct  161  AFSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVY 220
Query  176  PYVAREQQCR---RPNSQHYGISNYCQIYPPDVK-QIREALTQTHTAIAVIIGIKDLRAF 231
            PY A++ +CR   +P  +   I+ Y ++ P + +     AL     ++ V  G K ++ +
Sbjct  221  PYQAKQYKCRATDKPGPK-VKITGYKRV-PSNCETSFLGALANQPLSVLVEAGGKPFQLY 278
Query  232  QH--YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYF--QA 287
            +   +DG    + D       HAV  VGYG++ G +Y I++NSW   WG+ GY  +  Q+
Sbjct  279  KSGVFDGPCGTKLD-------HAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQS 331
Query  288  GNN 290
            GN+
Sbjct  332  GNS 334

Sequence Alignment: 31. Allergen Name: Blo t 1.0101 Sequence ID: AAK58415

 Score = 120.4 bits 499,  Expect = 6e-29
 Identities = 83/203 40%, Positives = 121/203 59%, Gaps = 18/203 8%
Query  91   VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 149
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
Query  150  -------HGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 200
                   HG +    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
Query  201  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIQHDNGYQPNY--HAVNIVG 257
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
Query  258  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 298
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216

Sequence Alignment: 32. Allergen Name: Blo t 1.0201 Sequence ID: AAQ24541

 Score = 118.9 bits 493,  Expect = 3e-28
 Identities = 113/284 39%, Positives = 158/284 55%, Gaps = 28/284 9%
Query  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKG------AINHLSDLSLDEFK 58
            IKTFE+FKK F K Y   EEE     +F E LK+VE + G      AIN  SD+S  EF 
Sbjct  25   IKTFEQFKKVFGKVYRNAEEEARREHHFKEQLKWVEEHNGIDGVEYAINEYSDMSEQEFS 84
Query  59   NRYLMSAEAFEQLKTQFDLNAEISACRINSV-NVPSELDLRSLRTVTPIRMQGGCGSCWA 117
                     F  +K +           IN+  ++P  +D R    +T IR QG CGSCWA
Sbjct  85   FHLSGGGLNFTYMKME-----AAKEPLINTYGSLPQNFDWRQKARLTRIRQQGSCGSCWA 139
Query  118  FSGVAATESAYLAYRNTSLDLSEQELVDCASQ--------HGRHGDTIPRGIEYIQQNGV 169
            F+     ES Y   +  S++LSEQELVDC           +G          +Y+ + G+
Sbjct  140  FAAAGVAESLYSIQKQQSIELSEQELVDCTYNRYDSSYQCNGCGSGYSTEAFKYMIRTGL 199
Query  170  VEERSYPYVAREQQCRRPN--SQHYGISNYCQI-YPPDVKQIREALTQTHTAIAVIIGIK 226
            VEE +YPY  R Q C  P+   Q Y +S Y Q+ Y    + +   + Q    +  + G  
Sbjct  200  VEEENYPYNMRTQWCN-PDVEGQRYHVSGYQQLRYQSSDEDVMYTIQQHGPVVIYMHGSN 258
Query  227  D-LRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYF 285
            + +R + +   R +  +D  Y    HAV +VG+G+ QGVDYWI+RNSW T WG+ GYGY 
Sbjct  259  NYFRNLGNGVLRGVAYND-AYTD--HAVILVGWGTVQGVDYWIIRNSWGTGWGNGGYGYV 315
Query  286  QAGNNLMMIEQY 297
            + G+N + I  +
Sbjct  316  ERGHNSLGINNF 327

Sequence Alignment: 33. Allergen Name: Act d 1 Sequence ID: P00785

 Score = 118.6 bits 492,  Expect = 4e-28
 Identities = 96/264 36%, Positives = 152/264 57%, Gaps = 25/264 9%
Query  8    FEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFKN 59
            +E +   + K+Y ++ E E   + F E+L++++ +        K  +N+++DL+ +EF++
Sbjct  42   YESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRS 101
Query  60   RYLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFS 119
             YL     F     +  ++      R   V +PS +D RS   V  I+ QG CG CWAFS
Sbjct  102  TYL----GFTSGSNKTKVSNRYEP-RFGQV-LPSYVDWRSAGAVVDIKSQGECGGCWAFS 155
Query  120  GVAATESAYLAYRNTSLDLSEQELVDCA-SQHGR--HGDTIPRGIEYIQQNGVVE-ERSY 175
             +A  E          + LSEQEL+DC  +Q+ R  +G  I  G ++I  NG +  E +Y
Sbjct  156  AIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENY 215
Query  176  PYVAREQQCRRP--NSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 233
            PY A++ +C     N ++  I  Y  +   +   ++ A+T    ++A +    D  AF+H
Sbjct  216  PYTAQDGECNLDLQNEKYVTIDTYENVPYNNEWALQTAVTYQPVSVA-LDAAGD--AFKH 272
Query  234  YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 282
            Y    I     G   + HAV IVGYG+  G+DYWIV+NSWDTTWG+ GY
Sbjct  273  YSS-GIFTGPCGTAID-HAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGY 319

Sequence Alignment: 34. Allergen Name: Act d 1 Sequence ID: AAA32629

 Score = 117.7 bits 488,  Expect = 7e-28
 Identities = 95/264 35%, Positives = 153/264 57%, Gaps = 25/264 9%
Query  8    FEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN--------KGAINHLSDLSLDEFKN 59
            +E +   + K+Y ++ E E   + F E+L++++ +        K  +N+++DL+ +EF++
Sbjct  42   YESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRS 101
Query  60   RYLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFS 119
             YL     F     +  ++      R+  V +PS +D RS   V  I+ QG CG CWAFS
Sbjct  102  TYL----GFTSGSNKTKVSNRYEP-RVGQV-LPSYVDWRSAGAVVDIKSQGECGGCWAFS 155
Query  120  GVAATESAYLAYRNTSLDLSEQELVDCA-SQHGR--HGDTIPRGIEYIQQNGVVE-ERSY 175
             +A  E          + LSEQEL+DC  +Q+ R  +G  I  G ++I  NG +  E +Y
Sbjct  156  AIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENY 215
Query  176  PYVAREQQC--RRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 233
            PY A++ +C     N ++  I  Y  +   +   ++ A+T    ++A +    D  AF++
Sbjct  216  PYTAQDGECNVELQNEKYVTIDTYENVPYNNEWALQTAVTYQPVSVA-LDAAGD--AFKQ 272
Query  234  YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGY 282
            Y    I     G   + HAV IVGYG+  G+DYWIV+NSWDTTWG+ GY
Sbjct  273  YSS-GIFTGPCGTAID-HAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGY 319

Sequence Alignment: 35. Allergen Name: Ana c 2 Sequence ID: BAA21849

 Score = 115.7 bits 479,  Expect = 3e-27
 Identities = 89/265 33%, Positives = 148/265 55%, Gaps = 26/265 9%
Query  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEA----NKGA----INHLSDLSLDE 56
            +K FEE+   + + Y   +E+    + F  ++K++E     N+ +    IN+++D++  E
Sbjct  34   MKRFEEWMAEYGRVYKDDDEKMRRFQIFKNNVKHIETFNSRNENSYTLGINQFTDMTKSE 93
Query  57   FKNRYLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCW 116
            F  +Y   +     L    +    +S   +N   VP  +D R    V  ++ Q  CGSCW
Sbjct  94   FVAQYTGVS-----LPLNIEREPVVSFDDVNISAVPQSIDWRDYGAVNEVKNQNPCGSCW 148
Query  117  AFSGVAATESAYLAYRNTSLDLSEQELVDCASQHGRHGDTIPRGIEYI-QQNGVVEERSY 175
            +F+ +A  E  Y       + LSEQE++DCA  +G  G  + +  ++I   NGV  E +Y
Sbjct  149  SFAAIATVEGIYKIKTGYLVSLSEQEVLDCAVSYGCKGGWVNKAYDFIISNNGVTTEENY 208
Query  176  PYVAREQQCRR---PNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQ 232
            PY+A +  C     PNS +  I+ Y  +   D + +  A+  ++  IA +I   +   FQ
Sbjct  209  PYLAYQGTCNANSFPNSAY--ITGYSYVRRNDERSMMYAV--SNQPIAALIDASE--NFQ 262
Query  233  HYDGRTIIQHDNGYQPNYHAVNIVGYGS-TQGVDYWIVRNSWDTTWGDSGY 282
            +Y+G  +     G   N HA+ I+GYG  + G  YWIVRNSW ++WG+ GY
Sbjct  263  YYNG-GVFSGPCGTSLN-HAITIIGYGQDSSGTKYWIVRNSWGSSWGEGGY 311

Sequence Alignment: 36. Allergen Name: Amb a 11.0101 Sequence ID: V5LU01

 Score = 111.3 bits 460,  Expect = 6e-26
 Identities = 90/276 32%, Positives = 143/276 51%, Gaps = 17/276 6%
Query  8    FEEFKKAFNKNYATVEEEEVARKN---FLESLKYVEANKGAINHLSDLSLDEFKNRYLMS 64
            ++ +++  N    + E   V + N     ES K  +  K  +N ++D++  EF N Y  S
Sbjct  40   YDRWREQHNIEMRSPERFNVFKYNVRRIHESNKMDKPYKLKVNEFADMTNLEFVNTYANS 99
Query  65   AEA-FEQLKTQ----FDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWAFS 119
              + F+ L+       D +        N   +P ++D R    VT ++ QGGCGSCWAF+
Sbjct  100  KISHFQALRGSAPGSIDTDPNKDFIYANVTKIPDKVDWREKNAVTDVKGQGGCGSCWAFA 159
Query  120  GVAATESAYLAYRNTSLDLSEQELVDC-ASQHGRHGDTIPRGIEY-IQQNGVVEERSYPY 177
             V A E          + +SEQ+LVDC  +  G  G  +     Y I++ G+  E SYPY
Sbjct  160  AVVALEGINAIRTGKLVKFSEQQLVDCDMTNAGCDGGLMEPAFTYVIKHGGIAPEASYPY 219
Query  178  VAREQQCRRPNSQHYGISNYCQIYPP-DVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG 236
            V + + C +   +     +  Q  P  D + +R+A+   H  +A  I +     +Q Y  
Sbjct  220  VGKRETCDKAKIKDVLKIDGRQNVPGLDEEALRKAV--AHQPVATGIQLSG-HGLQFYS- 275
Query  237  RTIIQHDNGYQPNYHAVNIVGYG-STQGVDYWIVRNSWDTTWGDSGYGYFQAG 288
              +   D G +PN H V IVGYG + +G+ +W V+NSW  TWG+ GY ++Q G
Sbjct  276  EGVYTGDCGTEPN-HGVGIVGYGENEKGIKFWTVKNSWGPTWGEKGYIHLQRG 327

Sequence Alignment: 37. Allergen Name: Gly m 1 Sequence ID: AAB09252

 Score = 104.0 bits 428,  Expect = 9e-24
 Identities = 92/287 32%, Positives = 147/287 51%, Gaps = 25/287 8%
Query  8    FEEFKKAFNKNYATVEEEEVARKNFLESLKYVE---ANKGA-------INHLSDLSLDEF 57
            F+ +K    + Y   EEE    + F  +  Y+    AN+ +       +N ++D++  EF
Sbjct  44   FQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITPQEF 103
Query  58   KNRYLMSA-EAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCW 116
              +YL +  +  +Q+K     N ++   + +  + P+  D R    +T ++ QGGCG  W
Sbjct  104  SKKYLQAPKDVSQQIKMA---NKKMKKEQYSCDHPPASWDWRKKGVITQVKYQGGCGRGW 160
Query  117  AFSGVAATESAYLAYRNTSLDLSEQELVDCASQ-HGRHGDTIPRGIEYI-QQNGVVEERS 174
            AFS   A E+A+       + LSEQELVDC  +  G +     +  E++ ++ G+  +  
Sbjct  161  AFSATGAIEAAHAIATGDLVSLSEQELVDCVEESEGSYNGWQYQSFEWVLEHGGIATDDD 220
Query  175  YPYVAREQQCRRPNSQ-HYGISNYCQIYPPDVKQIREALTQTHTAI---AVIIGIKDLRA 230
            YPY A+E +C+    Q    I  Y  +   D     E      +AI    + + I D + 
Sbjct  221  YPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILEQPISVSI-DAKD 279
Query  231  FQHYDGRTIIQHDNGYQPN--YHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 288
            F+ Y G  I   +N   P    H V +VGYGS  GVDYWI +NSW   WG+ GY + Q  
Sbjct  280  FHLYTG-GIYDGENCTSPYGINHFVLLVGYGSADGVDYWIAKNSWGEDWGEDGYIWIQRN 338
Query  289  N-NLMMIEQYPY 299
              NL+ +    Y
Sbjct  339  TGNLLGVCGMNY 350

Sequence Alignment: 38. Allergen Name: Gly m 1 Sequence ID: P22895

 Score = 103.8 bits 427,  Expect = 1e-23
 Identities = 92/287 32%, Positives = 147/287 51%, Gaps = 25/287 8%
Query  8    FEEFKKAFNKNYATVEEEEVARKNFLESLKYVE---ANKGA-------INHLSDLSLDEF 57
            F+ +K    + Y   EEE    + F  +  Y+    AN+ +       +N ++D++  EF
Sbjct  44   FQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMNANRKSPHSHRLGLNKFADITPQEF 103
Query  58   KNRYLMSA-EAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCW 116
              +YL +  +  +Q+K     N ++   + +  + P+  D R    +T ++ QGGCG  W
Sbjct  104  SKKYLQAPKDVSQQIKMA---NKKMKKEQYSCDHPPASWDWRKKGVITQVKYQGGCGRGW 160
Query  117  AFSGVAATESAYLAYRNTSLDLSEQELVDCASQ-HGRHGDTIPRGIEYI-QQNGVVEERS 174
            AFS   A E+A+       + LSEQELVDC  +  G +     +  E++ ++ G+  +  
Sbjct  161  AFSATGAIEAAHAIATGDLVSLSEQELVDCVEESEGSYNGWQYQSFEWVLEHGGIATDDD 220
Query  175  YPYVAREQQCRRPNSQ-HYGISNYCQIYPPDVKQIREALTQTHTAI---AVIIGIKDLRA 230
            YPY A+E +C+    Q    I  Y  +   D     E      +AI    + + I D + 
Sbjct  221  YPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILEQPISVSI-DAKD 279
Query  231  FQHYDGRTIIQHDNGYQPN--YHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 288
            F+ Y G  I   +N   P    H V +VGYGS  GVDYWI +NSW   WG+ GY + Q  
Sbjct  280  FHLYTG-GIYDGENCTSPYGINHFVLLVGYGSADGVDYWIAKNSWGFDWGEDGYIWIQRN 338
Query  289  N-NLMMIEQYPY 299
              NL+ +    Y
Sbjct  339  TGNLLGVCGMNY 350

Sequence Alignment: 39. Allergen Name: Car p papain Sequence ID: AAB02650

 Score = 103.4 bits 425,  Expect = 1e-23
 Identities = 91/270 33%, Positives = 144/270 53%, Gaps = 25/270 9%
Query  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYV-EANKG------AINHLSDLSLDEF 57
            I+ FE +    NK Y  ++E+    + F ++LKY+ E NK        +N ++D+S DEF
Sbjct  45   IQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEF 104
Query  58   KNRYLMSAEAFEQLKTQFDLNAEISACRINSVNVPSELDLRSLRTVTPIRMQGGCGSCWA 117
            K +Y  S  A     T++     ++      VN+P  +D R    VTP++ QG CGSCWA
Sbjct  105  KEKYTGSI-AGNYTTTELSYEEVLND---GDVNIPEYVDWRQKGAVTPVKNQGSCGSCWA 160
Query  118  FSGVAATESAYLAYRNTSLD-LSEQELVDCASQ-HGRHGDTIPRGIEYIQQNGVVEERSY 175
            FS V   E   +  R  +L+  SEQEL+DC  + +G +G      ++ + Q G+    +Y
Sbjct  161  FSAVVTIEGI-IKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTY 219
Query  176  PYVAREQQCRRPNSQHYGISN--YCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQH 233
            PY   ++ CR      Y        Q+ P +   +  ++     ++ +    KD   FQ 
Sbjct  220  PYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKD---FQL 276
Query  234  YDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAG 288
            Y G  I     G + + HAV  VGYG     +Y +++NSW T WG++GY   + G
Sbjct  277  YRG-GIFVGPCGNKVD-HAVAAVGYGP----NYILIKNSWGTGWGENGYIRIKRG 325

Sequence Alignment: 40. Allergen Name: Tyr p 1.0101 Sequence ID: ABM53753

 Score = 63.3 bits 249,  Expect = 2e-11
 Identities = 106/289 36%, Positives = 159/289 55%, Gaps = 34/289 11%
Query  5    IKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEANKGAINHLSDLSLDEFKNRYLMS 64
            + T+E++K  F KNY T+ EE   + N++ SL  +  N G  N ++ L L++  +    S
Sbjct  23   VPTWEQYKVKFGKNYLTINEENFRKNNYFNSLTKIVKNNGK-NGVT-LGLNDMSD---WS 77
Query  65   AEAFEQLKTQFDLNAEISACRINSVNV---PSELDLRSLRTVTPIRMQGGCGSCWAFSGV 121
             E F  L ++   +  +SA   ++VN    P   D R++     I  QG C SCWAF+  
Sbjct  78   DEEFFSLNSKSPSSVFVSARPTSTVNTSPFPKSWDWRNIIAFNSIEQQGRCSSCWAFAAA 137
Query  122  AATESAYLAYRNT-SLDLSEQELVDCAS----QH----GRHGDTIPRGIEYIQQNGVVEE 172
               E+AY   +N  +L LS QELVDC +    QH    G  G       +YI  +GV E+
Sbjct  138  TTVEAAYAHQKNKHNLHLSRQELVDCTNRTFDQHYLNYGCKGGWPTEAYKYIMDHGVYED 197
Query  173  RSYPYVAREQQ-CRRPNSQH-------YGISNYCQIYPPDVKQIREALTQTHTAIAVII- 223
            + Y Y     + C      H       Y ISNY ++   D  +   A+  T+    V I 
Sbjct  198  KLYHYTETFNEVCYADKVAHDKGHPVKYYISNYGRLAYNDTDEAIMAMLVTYGPGTVDIH 257
Query  224  GIKDLRAFQHYDGRTI--IQHDNGYQPNYHAVNIVGYGS-TQGVDYWIVRNSWDTTWGDS 280
            G  D   F+ Y G  +  +  ++ Y    H V +VGYG+ + GVDYWI+RNSW  TWG+ 
Sbjct  258  GTSD--TFRFYKGGIMRNVMPNSAY--TNHIVVVVGYGTDSSGVDYWIIRNSWGKTWGEH 313
Query  281  GYGYFQAGNNLMMIE-QYPYVVI 302
            GYG ++   NL+    +Y Y ++
Sbjct  314  GYGRLERHPNLLGFNNKYNYPIL 336

Sequence Alignment: 41. Allergen Name: Der m 1 Sequence ID: P16312

 Score = 50.1 bits 172,  Expect = 1e-08
 Identities = 27/28 96%, Positives = 27/28 96%, Gaps = 0/28 0%
Query  83   ACRINSVNVPSELDLRSLRTVTPIRMQG 110
            ACRINS NVPSELDLRSLRTVTPIRMQG
Sbjct  3    ACRINSGNVPSELDLRSLRTVTPIRMQG 30

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.