The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPQGPQQRPPLLQQCCNELHQEEP
LCVCPTLKGASRAVKQQVRQQQGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCPFQKT
MPGPS
Sequence Info Allergen Name Length Opt Bits Score E Value
P80208 Bra n 1 125 907 92.8 3e-21
P15322 Sin a 1 127 836 86.5 2.3e-19
P80207 Bra j 1 129 835 86.4 2.5e-19
CAA62911 Sin a 1 145 592 65.1 7.5e-13
CAA62910 Sin a 1 145 590 64.9 8.5e-13
CAA62912 Sin a 1 145 590 64.9 8.5e-13
CAA62908 Sin a 1 145 588 64.7 9.6e-13
AAB25214 Sin a 1 145 582 64.2 1.4e-12
CAA62909 Sin a 1 145 579 63.9 1.7e-12
Q42473 Bra r 1 178 552 61.7 9.5e-12
DQ631675 Pis v 1.0101 149 245 34.5 0.0013
Q8LPD3 Lin u 1.01 168 224 32.7 0.0048
Q8LPD3 Lin u 1.01 168 224 32.7 0.0048
AAO32314 Car i 1.0101 143 222 32.4 0.005
AAM54365 Jug n 1 161 217 32.1 0.0072
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bra n 1 Sequence ID: P80208

 Score = 92.8 bits 907,  Expect = 3e-21
 Identities = 125/125 100%, Positives = 125/125 100%, Gaps = 0/125 0%
Query  1    SAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPQGPQQRPPLLQQCCNELHQEEP 60
            SAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPQGPQQRPPLLQQCCNELHQEEP
Sbjct  1    SAGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPQGPQQRPPLLQQCCNELHQEEP 60
Query  61   LCVCPTLKGASRAVKQQVRQQQGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCPFQKT 120
            LCVCPTLKGASRAVKQQVRQQQGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCPFQKT
Sbjct  61   LCVCPTLKGASRAVKQQVRQQQGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCPFQKT 120
Query  121  MPGPS 125
            MPGPS
Sbjct  121  MPGPS 125

Sequence Alignment: 2. Allergen Name: Sin a 1 Sequence ID: P15322

 Score = 86.5 bits 836,  Expect = 2e-19
 Identities = 117/124 94%, Positives = 120/124 96%, Gaps = 2/124 1%
Query  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP--QGPQQRPPLLQQCCNELHQEE 59
            AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP  QGPQQRPPLLQQCCNELHQEE
Sbjct  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSPQGPQQRPPLLQQCCNELHQEE 61
Query  60   PLCVCPTLKGASRAVKQQVRQQQGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCPFQK 119
            PLCVCPTLKGAS+AVKQQVRQQ  QQGQQ  +VISRIYQTATHLPKVCNIPQVSVCPF+K
Sbjct  62   PLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHVISRIYQTATHLPKVCNIPQVSVCPFKK 121
Query  120  TMPGPS 125
            TMPGPS
Sbjct  122  TMPGPS 127

Sequence Alignment: 3. Allergen Name: Bra j 1 Sequence ID: P80207

 Score = 86.4 bits 835,  Expect = 2e-19
 Identities = 115/124 92%, Positives = 122/124 98%, Gaps = 5/124 4%
Query  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPQ--GPQQRPPLLQQCCNELHQEE 59
            AGPFR P+CRKEFQQAQHLRACQQWLHKQAMQSGSGPQ  GPQQRPPLLQQCCNELHQEE
Sbjct  1    AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEE 60
Query  60   PLCVCPTLKGASRAVKQQVRQQ---QGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCP 116
            PLCVCPTLKGAS+AVKQQ+RQQ   QGQQGQQLQ+ ISRIYQTATHLP+VCNIP+VS+CP
Sbjct  61   PLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICP 120
Query  117  FQKTMPGPS 125
            FQKTMPGPS
Sbjct  121  FQKTMPGPS 129

Sequence Alignment: 4. Allergen Name: Sin a 1 Sequence ID: CAA62911

 Score = 65.1 bits 592,  Expect = 7e-13
 Identities = 118/124 95%, Positives = 122/124 98%, Gaps = 20/124 16%
Query  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP-----------------QGPQQR 44
            AGPF IPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP                 QGPQQR
Sbjct  2    AGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQR 61
Query  45   PPLLQQCCNELHQEEPLCVCPTLKGASRAVKQQVRQQ---QGQQGQQLQQVISRIYQTAT 101
            PPLLQQCCNELHQEEPLCVCPTLKGAS+AVKQQVRQQ   QGQQG Q+Q+VISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTAT 121
Query  102  HLPKVCNIPQVSVCPFQKTMPGPS 125
            HLPKVCNIPQVSVCPF+KTMPGPS
Sbjct  122  HLPKVCNIPQVSVCPFKKTMPGPS 145

Sequence Alignment: 5. Allergen Name: Sin a 1 Sequence ID: CAA62910

 Score = 64.9 bits 590,  Expect = 8e-13
 Identities = 119/124 95%, Positives = 123/124 99%, Gaps = 20/124 16%
Query  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP-----------------QGPQQR 44
            AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP                 QGPQQR
Sbjct  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLEGEFDFEDDMENPQGPQQR 61
Query  45   PPLLQQCCNELHQEEPLCVCPTLKGASRAVKQQVRQQ---QGQQGQQLQQVISRIYQTAT 101
            PPLLQQCCNELHQEEPLCVCPTLKGAS+AVKQQVRQQ   QGQQG +LQ+VISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTAT 121
Query  102  HLPKVCNIPQVSVCPFQKTMPGPS 125
            HLPKVCNIPQVSVCPF+KTMPGPS
Sbjct  122  HLPKVCNIPQVSVCPFKKTMPGPS 145

Sequence Alignment: 6. Allergen Name: Sin a 1 Sequence ID: CAA62912

 Score = 64.9 bits 590,  Expect = 8e-13
 Identities = 119/124 95%, Positives = 123/124 99%, Gaps = 20/124 16%
Query  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP-----------------QGPQQR 44
            AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP                 QGPQQR
Sbjct  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQR 61
Query  45   PPLLQQCCNELHQEEPLCVCPTLKGASRAVKQQVRQQ---QGQQGQQLQQVISRIYQTAT 101
            PPLLQQCCNELHQEEPLCVCPTLKGAS+AVKQQVRQQ   QGQQG +LQ+VISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTAT 121
Query  102  HLPKVCNIPQVSVCPFQKTMPGPS 125
            HLPKVCNIPQVSVCPF+KTMPGPS
Sbjct  122  HLPKVCNIPQVSVCPFKKTMPGPS 145

Sequence Alignment: 7. Allergen Name: Sin a 1 Sequence ID: CAA62908

 Score = 64.7 bits 588,  Expect = 1e-12
 Identities = 117/124 94%, Positives = 122/124 98%, Gaps = 20/124 16%
Query  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP-----------------QGPQQR 44
            AGPF IPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP                 QGPQQ+
Sbjct  2    AGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQK 61
Query  45   PPLLQQCCNELHQEEPLCVCPTLKGASRAVKQQVRQQ---QGQQGQQLQQVISRIYQTAT 101
            PPLLQQCCNELHQEEPLCVCPTLKGAS+AVKQQVRQQ   QGQQG Q+Q+VISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTAT 121
Query  102  HLPKVCNIPQVSVCPFQKTMPGPS 125
            HLPKVCNIPQVSVCPF+KTMPGPS
Sbjct  122  HLPKVCNIPQVSVCPFKKTMPGPS 145

Sequence Alignment: 8. Allergen Name: Sin a 1 Sequence ID: AAB25214

 Score = 64.2 bits 582,  Expect = 1e-12
 Identities = 119/124 95%, Positives = 122/124 98%, Gaps = 20/124 16%
Query  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP-----------------QGPQQR 44
            AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP                 QGPQQR
Sbjct  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQR 61
Query  45   PPLLQQCCNELHQEEPLCVCPTLKGASRAVKQQVRQQQGQQGQQ---LQQVISRIYQTAT 101
            PPLLQQCCNELHQEEPLCVCPTLKGAS+AVKQQVRQQ GQQGQQ   LQ+VISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPHLQHVISRIYQTAT 121
Query  102  HLPKVCNIPQVSVCPFQKTMPGPS 125
            HLPKVCNI QVSVCPF+KTMPGPS
Sbjct  122  HLPKVCNIRQVSVCPFKKTMPGPS 145

Sequence Alignment: 9. Allergen Name: Sin a 1 Sequence ID: CAA62909

 Score = 63.9 bits 579,  Expect = 2e-12
 Identities = 117/124 94%, Positives = 121/124 97%, Gaps = 20/124 16%
Query  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP-----------------QGPQQR 44
            AGPF IPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP                 QGPQQR
Sbjct  2    AGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQR 61
Query  45   PPLLQQCCNELHQEEPLCVCPTLKGASRAVKQQVRQQ---QGQQGQQLQQVISRIYQTAT 101
            PPLLQQCCNELHQEEPLCVCPTLKGAS+AVKQQVRQQ   QGQQG +LQ+VISRIYQTAT
Sbjct  62   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLEQQGQQGPHLQHVISRIYQTAT 121
Query  102  HLPKVCNIPQVSVCPFQKTMPGPS 125
            HLP+VCNI QVSVCPFQKTMPGPS
Sbjct  122  HLPRVCNIRQVSVCPFQKTMPGPS 145

Sequence Alignment: 10. Allergen Name: Bra r 1 Sequence ID: Q42473

 Score = 61.7 bits 552,  Expect = 1e-11
 Identities = 114/122 93%, Positives = 120/122 98%, Gaps = 19/122 15%
Query  2    AGPFRIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGP-----------------QGPQQR 44
            AGPFRIPKCRKEFQQAQHL+ACQQWLHKQAMQSGSGP                 QGPQQ 
Sbjct  39   AGPFRIPKCRKEFQQAQHLKACQQWLHKQAMQSGSGPSWTLDGEFDFEEDMENTQGPQQE 98
Query  45   PPLLQQCCNELHQEEPLCVCPTLKGASRAVKQQVRQQQGQQGQQLQQVISRIYQTATHLP 104
            PPLLQQCCNELHQEEPLCVCPTLKGAS+AVKQQVRQQ GQQ QQ+QQVISRIYQT+THLP
Sbjct  99   PPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQ-GQQ-QQMQQVISRIYQTSTHLP 156
Query  105  KVCNIPQVSVCPFQKTMPGPS 125
            +VCNI QVS+CPFQKTMPGPS
Sbjct  157  RVCNIRQVSICPFQKTMPGPS 177

Sequence Alignment: 11. Allergen Name: Pis v 1.0101 Sequence ID: DQ631675

 Score = 34.5 bits 245,  Expect = 0.001
 Identities = 39/99 39%, Positives = 68/99 68%, Gaps = 13/99 13%
Query  10   CRKEFQQAQHLRACQQWLHKQAMQSGSGPQGP---QQRPPLLQQCCNELHQEEPLCVCPT 66
            C+K+F++ Q ++ CQ +++++  +S  G        QR   ++QCC EL++ +  C C  
Sbjct  40   CQKQFEEQQKFKHCQMYVQQEVQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQN 99
Query  67   LKGASRAVKQQVRQQQGQ-QGQQLQQVISRIYQTATHLPKVCNIPQVSVCPF 117
            L+   + VK+Q  QQQGQ +G++LQ+    +Y+TA+ LP++CNI     C F
Sbjct  100  LE---QMVKRQ--QQQGQFRGEKLQE----LYETASELPRMCNISPSQGCQF 142

Sequence Alignment: 12. Allergen Name: Lin u 1.01 Sequence ID: Q8LPD3

 Score = 32.7 bits 224,  Expect = 0.005
 Identities = 37/107 34%, Positives = 62/107 57%, Gaps = 8/107 7%
Query  9    KCRKEFQQAQHLRACQQWLHKQAMQSGSG-----PQGPQQRPPLLQQCCNELHQEEPLCV 63
            +C K+ Q+  +LR+CQQ+L ++  + G        +G  Q+   +  CC++L Q    C 
Sbjct  49   QCEKQIQEQDYLRSCQQFLWEKVQKGGRSYYYNQGRGGGQQSQHFDSCCDDLKQLRSECT 108
Query  64   CPTLKGASRAVKQQVRQQQGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCPFQ 118
            C  L+ A   ++Q + QQQGQQ Q++++ + +  Q A  LP  C   Q S C +Q
Sbjct  109  CRGLERAIGQMRQDI-QQQGQQ-QEVERWVQQAKQVARDLPGQCGT-QPSRCQLQ 160

Sequence Alignment: 13. Allergen Name: Lin u 1.01 Sequence ID: Q8LPD3

 Score = 32.7 bits 224,  Expect = 0.005
 Identities = 37/107 34%, Positives = 62/107 57%, Gaps = 8/107 7%
Query  9    KCRKEFQQAQHLRACQQWLHKQAMQSGSG-----PQGPQQRPPLLQQCCNELHQEEPLCV 63
            +C K+ Q+  +LR+CQQ+L ++  + G        +G  Q+   +  CC++L Q    C 
Sbjct  49   QCEKQIQEQDYLRSCQQFLWEKVQKGGRSYYYNQGRGGGQQSQHFDSCCDDLKQLRSECT 108
Query  64   CPTLKGASRAVKQQVRQQQGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCPFQ 118
            C  L+ A   ++Q + QQQGQQ Q++++ + +  Q A  LP  C   Q S C +Q
Sbjct  109  CRGLERAIGQMRQDI-QQQGQQ-QEVERWVQQAKQVARDLPGQCGT-QPSRCQLQ 160

Sequence Alignment: 14. Allergen Name: Car i 1.0101 Sequence ID: AAO32314

 Score = 32.4 bits 222,  Expect = 0.005
 Identities = 37/103 35%, Positives = 65/103 63%, Gaps = 12/103 11%
Query  6    RIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPQGPQQRPPLLQQCCNELHQEEPLCVCP 65
            R   CR++ Q+ Q+L  CQ +L +Q    G      +Q    ++QCC +L Q E  C C 
Sbjct  39   RGESCREQIQRQQYLNRCQDYLRQQCRSGGYDEDNQRQH---FRQCCQQLSQMEEQCQC- 94
Query  66   TLKGASRAVKQQVRQQQGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCPFQKT 120
              +G  +AV+QQ +Q++G +G+++++++    Q A+ LPK C I   S C  +++
Sbjct  95   --EGLRQAVRQQ-QQEEGIRGEEMEEMV----QCASDLPKECGISSRS-CEIRRS 141

Sequence Alignment: 15. Allergen Name: Jug n 1 Sequence ID: AAM54365

 Score = 32.1 bits 217,  Expect = 0.007
 Identities = 36/99 36%, Positives = 62/99 62%, Gaps = 12/99 12%
Query  10   CRKEFQQAQHLRACQQWLHKQAMQSGSGPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKG 69
            C+++ Q+ Q+L  CQ +L +Q+   G      +Q    ++QCC +L Q E  C C  L+ 
Sbjct  61   CQEQIQRQQNLNHCQYYLRQQSRSGGYDEDNQRQH---FRQCCQQLSQIEEQCQCEGLRQ 117
Query  70   ASRAVKQQVRQQQGQQGQQLQQVISRIYQTATHLPKVCNIPQVSVCPFQKT 120
            A R  +QQ  QQQG +G+++++++    Q+A  LPK C I     C  +++
Sbjct  118  AVR--RQQ--QQQGLRGEEMEEMV----QSARDLPKECGISS-QRCEIRRS 159

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.