The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALL
PLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWG
NMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYY
GYPYCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGR
VKEAVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSS
DVNSLSKCKRLREYLLTVLGPITVNVTETVN
Sequence Info Allergen Name Length Opt Bits Score E Value
P49371 Dol m 2 331 2288 528.0 2e-151
P49370 Ves v 2.0101 331 2122 490.2 4.9e-140
Q9U6V9 Pol a 2 367 1845 427.0 5.7e-121
XP_015179722 Pol d 2.0101 365 1826 422.7 1.1e-119
P86687 Poly p 2.0101 288 1630 378.1 2.4e-106
AAX14718 Ves v 2.0201 340 1432 332.9 1.1e-92
Q08169 Api m 2 382 1300 302.8 1.5e-83
ADM18346 Tab y 2.0101 349 922 216.6 1.2e-57
6736487 Ves m 2.0101 31 132 41.0 7.5e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Dol m 2 Sequence ID: P49371

 Score = 528.0 bits 2288,  Expect = 2e-151
 Identities = 331/331 100%, Positives = 331/331 100%, Gaps = 0/331 0%
Query  1    SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALL 60
            SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALL
Sbjct  1    SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALL 60
Query  61   PLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWG 120
            PLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWG
Sbjct  61   PLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWG 120
Query  121  NMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYY 180
            NMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYY
Sbjct  121  NMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYY 180
Query  181  GYPYCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGR 240
            GYPYCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGR
Sbjct  181  GYPYCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGR 240
Query  241  VKEAVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSS 300
            VKEAVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSS
Sbjct  241  VKEAVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSS 300
Query  301  DVNSLSKCKRLREYLLTVLGPITVNVTETVN 331
            DVNSLSKCKRLREYLLTVLGPITVNVTETVN
Sbjct  301  DVNSLSKCKRLREYLLTVLGPITVNVTETVN 331

Sequence Alignment: 2. Allergen Name: Ves v 2.0101 Sequence ID: P49370

 Score = 490.2 bits 2122,  Expect = 5e-140
 Identities = 303/331 91%, Positives = 317/331 95%, Gaps = 0/331 0%
Query  1    SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALL 60
            SERPKRVFNIYWNVPTFMCHQY LYFDEVTNFNIK NSKDDFQGDKI+IFYDPGEFPALL
Sbjct  1    SERPKRVFNIYWNVPTFMCHQYDLYFDEVTNFNIKRNSKDDFQGDKIAIFYDPGEFPALL 60
Query  61   PLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWG 120
             LK+G YK RNGGVPQEGNITIHLQ+FIENLDK YPNRNF+GIGVIDFERWRPIFRQNWG
Sbjct  61   SLKDGKYKKRNGGVPQEGNITIHLQKFIENLDKIYPNRNFSGIGVIDFERWRPIFRQNWG 120
Query  121  NMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYY 180
            NM IHK FSIDLVRNEHP W+KKMIELEASKRFEKYAR+FMEETLKLAKKTRKQADWGYY
Sbjct  121  NMKIHKNFSIDLVRNEHPTWNKKMIELEASKRFEKYARFFMEETLKLAKKTRKQADWGYY 180
Query  181  GYPYCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGR 240
            GYPYCFNMSPNNLVP+CD TAM ENDKMSWLFNNQNVLLPSVY+R+ELTPDQR+GLVQGR
Sbjct  181  GYPYCFNMSPNNLVPECDVTAMHENDKMSWLFNNQNVLLPSVYVRQELTPDQRIGLVQGR 240
Query  241  VKEAVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSS 300
            VKEAVRISNNLKHSPKVLSYWWYVYQD+TNTFLTETDVKKTFQEI INGGDGIIIWGSSS
Sbjct  241  VKEAVRISNNLKHSPKVLSYWWYVYQDETNTFLTETDVKKTFQEIVINGGDGIIIWGSSS 300
Query  301  DVNSLSKCKRLREYLLTVLGPITVNVTETVN 331
            DVNSLSKCKRL++YLLTVLGPI +NVTE VN
Sbjct  301  DVNSLSKCKRLQDYLLTVLGPIAINVTEAVN 331

Sequence Alignment: 3. Allergen Name: Pol a 2 Sequence ID: Q9U6V9

 Score = 427.0 bits 1845,  Expect = 6e-121
 Identities = 252/331 76%, Positives = 295/331 89%, Gaps = 0/331 0%
Query  1    SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALL 60
            S+RPKRVF+IYWNVPTFMCHQYG+ FDEVT+FNIKHNSKD+F+G+ ISI+YDPG+FPAL+
Sbjct  30   SKRPKRVFSIYWNVPTFMCHQYGMNFDEVTDFNIKHNSKDNFRGETISIYYDPGKFPALM 89
Query  61   PLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWG 120
            PLK GNY+ RNGGVPQ GNITIHLQ+F E+LDK  P++NF GIGVIDFERW+PIFRQNWG
Sbjct  90   PLKNGNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGIGVIDFERWKPIFRQNWG 149
Query  121  NMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYY 180
            N  IHKK+SI+LVR EHP W + MIE EA+K+FEKYAR FMEETLKLAKKTRK+A WGYY
Sbjct  150  NTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKTRKRAKWGYY 209
Query  181  GYPYCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGR 240
            G+PYC+N++PNN  PDCDA A +END++SW++NNQ +L+PSVY+RHE  P++RV LVQGR
Sbjct  210  GFPYCYNVTPNNPGPDCDAKATIENDRLSWMYNNQEILFPSVYVRHEQKPEERVYLVQGR 269
Query  241  VKEAVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSS 300
            +KEAVRISNNL+HSP VL+YWWYVYQD  + +L+ETDV+KTFQEI  NGGDGIIIWGSSS
Sbjct  270  IKEAVRISNNLEHSPSVLAYWWYVYQDKMDIYLSETDVEKTFQEIVTNGGDGIIIWGSSS 329
Query  301  DVNSLSKCKRLREYLLTVLGPITVNVTETVN 331
            DVNSLSKCKRLREYLL  LGP  VNVTETVN
Sbjct  330  DVNSLSKCKRLREYLLNTLGPFAVNVTETVN 360

Sequence Alignment: 4. Allergen Name: Pol d 2.0101 Sequence ID: XP_015179722

 Score = 422.7 bits 1826,  Expect = 1e-119
 Identities = 251/331 75%, Positives = 295/331 89%, Gaps = 1/331 0%
Query  1    SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALL 60
            S+RPKRVF+IYWNVPTFMCHQYG+ FDEVT+FNIKHNSKD+F+G+ I+I+YDPG+FPAL+
Sbjct  27   SKRPKRVFSIYWNVPTFMCHQYGMNFDEVTDFNIKHNSKDNFRGETIAIYYDPGKFPALM 86
Query  61   PLKE-GNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNW 119
            PL   G Y+ RNGGVPQ GNITIHLQ+F E+LDK  P+RNF GIGVIDFERWRPIFRQNW
Sbjct  87   PLNNNGKYEERNGGVPQLGNITIHLQQFNEDLDKMTPDRNFGGIGVIDFERWRPIFRQNW 146
Query  120  GNMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGY 179
            GN  IHKK+SI+LVR EHP W + MIE EA+K+FEKYAR FMEETLKLAKK+RK+A WGY
Sbjct  147  GNTEIHKKYSIELVRKEHPKWSESMIEAEATKKFEKYARYFMEETLKLAKKSRKRAKWGY 206
Query  180  YGYPYCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQG 239
            YG+PYC+N++PNN  PDCDA A++END++SW++NNQ +LLPSVY+RHE  P++R+ LVQG
Sbjct  207  YGFPYCYNVTPNNPGPDCDAKAIIENDRLSWMYNNQEILLPSVYLRHEQKPEERIYLVQG 266
Query  240  RVKEAVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSS 299
            R+KEAVRISNNL+HSP VL+YWWYVYQD  + +L+ETDVKKTFQEI  NGG+GIIIWGSS
Sbjct  267  RIKEAVRISNNLEHSPSVLAYWWYVYQDKMDIYLSETDVKKTFQEIVTNGGNGIIIWGSS 326
Query  300  SDVNSLSKCKRLREYLLTVLGPITVNVTETVN 331
            SDVNSLSKCKRLREYLL  LGPI VNVTETVN
Sbjct  327  SDVNSLSKCKRLREYLLNTLGPIAVNVTETVN 358

Sequence Alignment: 5. Allergen Name: Poly p 2.0101 Sequence ID: P86687

 Score = 378.1 bits 1630,  Expect = 2e-106
 Identities = 227/288 78%, Positives = 257/288 89%, Gaps = 0/288 0%
Query  44   GDKISIFYDPGEFPALLPLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGI 103
            G+ ISI+YDPG+FPAL+PLK GNY+ RNGGVPQ GNITIHLQ+F E+LDK  P++NF GI
Sbjct  1    GETISIYYDPGKFPALMPLKNGNYEERNGGVPQRGNITIHLQQFNEDLDKMTPDKNFGGI 60
Query  104  GVIDFERWRPIFRQNWGNMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEE 163
            GVIDFERW+PIFRQNWGN  IHKK+SI+LVR EHP W + MIE EA+K+FEKYARLFMEE
Sbjct  61   GVIDFERWKPIFRQNWGNTEIHKKYSIELVRYEHPKWSESMIEAEATKKFEKYARLFMEE 120
Query  164  TLKLAKKTRKQADWGYYGYPYCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVY 223
            TLKLAKKTRK+A WGYYG+PYC+N +PNN  PDCDA AM+END++SW++NNQ +L+PSVY
Sbjct  121  TLKLAKKTRKRAKWGYYGFPYCYNYTPNNPGPDCDAKAMIENDRLSWMYNNQEILFPSVY 180
Query  224  IRHELTPDQRVGLVQGRVKEAVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQ 283
            +RHELTPDQRV LVQGR+KEAVRISNNLKHSPKVLSYWWYVYQD  + FL+ETDVKKTFQ
Sbjct  181  VRHELTPDQRVYLVQGRIKEAVRISNNLKHSPKVLSYWWYVYQDKMDIFLSETDVKKTFQ 240
Query  284  EIAINGGDGIIIWGSSSDVNSLSKCKRLREYLLTVLGPITVNVTETVN 331
            EI  NGGDGIIIWGSSSDVNSLSKCKRLREYLL  LGP  VNVTETVN
Sbjct  241  EIVTNGGDGIIIWGSSSDVNSLSKCKRLREYLLNTLGPFAVNVTETVN 288

Sequence Alignment: 6. Allergen Name: Ves v 2.0201 Sequence ID: AAX14718

 Score = 332.9 bits 1432,  Expect = 1e-92
 Identities = 195/327 59%, Positives = 254/327 77%, Gaps = 0/327 0%
Query  4    PKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALLPLK 63
            PK+ F+IYWN+PT  CH +G+YF E+  FNIK+NS ++F+G+ IS+FYDPG FP+++ LK
Sbjct  6    PKKGFSIYWNIPTHFCHNFGVYFKELKQFNIKYNSMNNFRGETISLFYDPGNFPSMVLLK 65
Query  64   EGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWGNMM 123
             G Y+IRN GVPQ+GN+TIHL++F + LD+ YP +   GIGVI F  WRPIFR+N  N+ 
Sbjct  66   NGTYEIRNEGVPQKGNLTIHLEQFTKELDEIYPKKIAGGIGVIHFHNWRPIFRRNVDNLK 125
Query  124  IHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYP 183
            I+K  SIDLVR EHP WDK MIE EAS RFE  A++FME+TLKLAK+ RK+ +WGY+GYP
Sbjct  126  INKDISIDLVRKEHPKWDKSMIEKEASNRFETSAKIFMEKTLKLAKEIRKKTEWGYHGYP 185
Query  184  YCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGRVKE 243
            +C++ S +    DCDA +M ENDKMSWLFNNQNVLLPS+Y+++ L PD+++ LVQ R+KE
Sbjct  186  HCLSGSTDKPSFDCDALSMSENDKMSWLFNNQNVLLPSIYLKNVLKPDEKIHLVQERLKE 245
Query  244  AVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSSDVN 303
            A+RIS N+KH PKVL YWWY YQD  + FLTE DVK TF+EI  NG DGIIIWG S ++ 
Sbjct  246  AIRISKNFKHLPKVLPYWWYTYQDKESIFLTEADVKNTFKEILTNGADGIIIWGVSYELT 305
Query  304  SLSKCKRLREYLLTVLGPITVNVTETV 330
               +C++L+EYL+ +LGPI   VT+ V
Sbjct  306  DRKRCEKLKEYLMKILGPIAFKVTKAV 332

Sequence Alignment: 7. Allergen Name: Api m 2 Sequence ID: Q08169

 Score = 302.8 bits 1300,  Expect = 1e-83
 Identities = 183/316 57%, Positives = 239/316 75%, Gaps = 2/316 0%
Query  6    RVFNIYWNVPTFMCHQYGLYFDEVTN-FNIKHNSKDDFQGDKISIFYDPGEFPALLPLKE 64
            R FN+YWNVPTFMCH+YGL F+EV+  + I +N  D F+G++I+I+YDPG FPALL    
Sbjct  41   REFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLKDPN 100
Query  65   GNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWGNMMI 124
            GN   RNGGVPQ GN+T HLQ F ++L    P+++F G+GVIDFE WRPIFRQNW ++  
Sbjct  101  GNVVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQP 160
Query  125  HKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYPY 184
            +KK+S+++VR EHPFWD + +E EA +RFEKY +LFMEETLK AK+ R  A+WGYY YPY
Sbjct  161  YKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPY 220
Query  185  CFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGRVKEA 244
            C+N++PN     C+AT M ENDKMSWLF +++VLLPSVY+R  LT  +RVGLV GRVKEA
Sbjct  221  CYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEA 280
Query  245  VRISNNLKHS-PKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSSDVN 303
            +RI+  +  S  KVL Y+WY YQD  +T L+  D++ T+++I   G DG IIWGSS D+N
Sbjct  281  LRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDIN 340
Query  304  SLSKCKRLREYLLTVLGP 321
            + +KC ++REYL   LGP
Sbjct  341  TKAKCLQFREYLNNELGP 358

Sequence Alignment: 8. Allergen Name: Tab y 2.0101 Sequence ID: ADM18346

 Score = 216.6 bits 922,  Expect = 1e-57
 Identities = 136/322 42%, Positives = 212/322 65%, Gaps = 6/322 1%
Query  6    RVFNIYWNVPTFMC-HQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALLPLKE 64
            R F +YWN+PTFMC  Q     D      + +N++D F+GDKIS++Y PG FPA+   K 
Sbjct  24   RKFEVYWNIPTFMCPDQNKTIMDLNKKHGVIQNTEDLFRGDKISLLYHPGAFPAITRNKT 83
Query  65   GNYKI-RNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWGNMM 123
             N  I  NGGVPQ GN+++HL+ + +++++   ++NF+G+ VIDFE WRPIFRQN G++ 
Sbjct  84   TNTLIYENGGVPQAGNLSLHLKLLEKDINEQITDKNFSGLAVIDFELWRPIFRQNGGSLS 143
Query  124  IHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYP 183
             ++ +S+ L ++ HP +++  +  EA +R EK+ R F+++TL  AKK R +A WGYY +P
Sbjct  144  DYQNLSLKLEKDLHPEFNEDQLRKEAERRIEKFGRSFIKQTLIKAKKLRPKAQWGYYAFP 203
Query  184  YCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGRVKE 243
            YCFN      V  C  +A ++ND++ ++F N +V+ P+VY++ +L    + GLV+GRV E
Sbjct  204  YCFN-GRRRYVDTCIPSAKIDNDRILYMFENSDVIYPAVYLQTDLAQKNQTGLVKGRVDE 262
Query  244  AVRISNNLKH--SPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSSD 301
            AVR++  +K    P VL Y  YV+ D T  ++++ +    F+ +  NG DG+IIWGSS D
Sbjct  263  AVRMAKMVKKPAKPPVLVYHRYVFTD-TLEYISKENTTAVFKAMKDNGADGVIIWGSSFD 321
Query  302  VNSLSKCKRLREYLLTVLGPITVNVTET 329
            +NS  KC ++ +YL  VL P+   V  +
Sbjct  322  LNSKEKCAKFLDYLREVLWPVIDEVKRS 349

Sequence Alignment: 9. Allergen Name: Ves m 2.0101 Sequence ID: 6736487

 Score = 41.0 bits 132,  Expect = 8e-06
 Identities = 15/26 57%, Positives = 20/26 76%, Gaps = 0/26 0%
Query  4    PKRVFNIYWNVPTFMCHQYGLYFDEV 29
            PK  F+IYWN+PT  CH +G+YF E+
Sbjct  6    PKEGFSIYWNIPTHFCHNFGVYFKEL 31

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.