The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SGPWMCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADISEWPRCGALYSM
LDSMYKEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAA
YPDA
Sequence Info Allergen Name Length Opt Bits Score E Value
P01084 Tri a TAI 124 885 126.6 2e-31
P01085 Tri a TAI 124 835 120.0 1.9e-29
CAI84642 Tri a 28.0101 119 790 114.1 1.1e-27
P01083 Tri a TAI 123 504 76.7 2e-16
CBA13560 Tri a 15.0101 121 461 71.1 9.7e-15
CAA08836 Hor v 1 152 373 59.6 3.4e-11
P16968 Hor v 1 146 332 54.3 1.4e-09
P16968 Hor v 15.0101 146 332 54.3 1.4e-09
P10846 Tri a TAI 44 317 52.0 2e-09
BAA01997 Ory s TAI 162 290 48.8 6.6e-08
BAA01996 Ory s TAI 157 279 47.4 1.8e-07
BAA01998 Ory s TAI 165 273 46.6 3.1e-07
BAA07713 Ory s TAI 160 270 46.2 4e-07
BAA07711 Ory s TAI 160 270 46.2 4e-07
BAA02000 Ory s TAI 166 270 46.2 4.2e-07
BAA07710 Ory s TAI 166 262 45.2 8.6e-07
BAA07712 Ory s TAI 157 241 42.4 5.5e-06
BAA07774 Ory s TAI 113 187 35.2 0.00056
BAA07773 Ory s TAI 109 186 35.1 0.00059
BAA07772 Ory s TAI 111 185 35.0 0.00066
BAA01999 Ory s TAI 95 181 34.4 0.00084
AAB99797 Ory s TAI 157 164 32.3 0.0059
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 126.6 bits 885,  Expect = 2e-31
 Identities = 124/124 100%, Positives = 124/124 100%, Gaps = 0/124 0%
Query  1    SGPWMCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADISEWPRCGALYSM 60
            SGPWMCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADISEWPRCGALYSM
Sbjct  1    SGPWMCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADISEWPRCGALYSM 60
Query  61   LDSMYKEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAA 120
            LDSMYKEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAA
Sbjct  61   LDSMYKEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAA 120
Query  121  YPDA 124
            YPDA
Sbjct  121  YPDA 124

Sequence Alignment: 2. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 120.0 bits 835,  Expect = 2e-29
 Identities = 117/124 94%, Positives = 118/124 95%, Gaps = 0/124 0%
Query  1    SGPWMCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADISEWPRCGALYSM 60
            SGPWMCYPGQAFQVPALP CRPLL+LQCNGSQVPEAVLRDCCQQLA ISEW RCGALYSM
Sbjct  1    SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSM 60
Query  61   LDSMYKEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAA 120
            LDSMYKEHG  EGQAGTGAFP CRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAA
Sbjct  61   LDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAA 120
Query  121  YPDA 124
            YPDA
Sbjct  121  YPDA 124

Sequence Alignment: 3. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 114.1 bits 790,  Expect = 1e-27
 Identities = 112/119 94%, Positives = 113/119 94%, Gaps = 0/119 0%
Query  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADISEWPRCGALYSMLDSMY 65
            CYPGQAFQVPALP CRPLL+LQCNGSQVPEAVLRDCCQQLA ISEW RCGALYSMLDSMY
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMY 60
Query  66   KEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA 124
            KEHG  EGQAGTGAFP CRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA
Sbjct  61   KEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA 119

Sequence Alignment: 4. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 76.7 bits 504,  Expect = 2e-16
 Identities = 78/119 65%, Positives = 93/119 78%, Gaps = 7/119 5%
Query  1    SGPW-MCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADIS-EWPRCGALY 58
            SGPW  C P   ++V AL GCR ++KLQC GSQVPEAVLRDCCQQLADI+ EW RCG L 
Sbjct  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADINNEWCRCGDLS 60
Query  59   SMLDSMYKEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCK-D 117
            SML S+Y+E GV EG+     +P CR+EV+KLTAAS+  VC++PI  + SGD A VC  D
Sbjct  61   SMLRSVYQELGVREGKE---VLPGCRKEVMKLTAASVPEVCKVPIP-NPSGDRAGVCYGD 116
Query  118  VAAYPD 123
             AAYPD
Sbjct  117  WAAYPD 122

Sequence Alignment: 5. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 71.1 bits 461,  Expect = 1e-14
 Identities = 73/118 61%, Positives = 89/118 75%, Gaps = 7/118 5%
Query  1    SGPW-MCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADIS-EWPRCGALY 58
            SGPW  C P   ++V AL GCR ++KLQC GSQVPEAVLRDCCQQLAD++ EW RC  L 
Sbjct  1    SGPWSWCDPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADVNNEWCRCEDLS 60
Query  59   SMLDSMYKEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDV 118
            SML S+Y+E G  EG+     +P CR+EV+KLTAAS+  V ++PI  + SGD A VC   
Sbjct  61   SMLRSVYQELGAREGKE---VLPGCRKEVMKLTAASVPEVRKVPIP-NPSGDRAGVCY-W 115
Query  119  AAYPD 123
            AAYPD
Sbjct  116  AAYPD 120

Sequence Alignment: 6. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 59.6 bits 373,  Expect = 3e-11
 Identities = 58/112 51%, Positives = 76/112 67%, Gaps = 5/112 4%
Query  1    SGPWM-CYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADIS-EWPRCGALY 58
            SGPWM C P    +V  L  CR L+KL+C G++VPE VLRDCCQ++A+IS EW RCG L 
Sbjct  31   SGPWMWCDPEMGHKVSPLTRCRALVKLECVGNRVPEDVLRDCCQEVANISNEWCRCGDLG 90
Query  59   SMLDSMYKEHGVSEGQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
            SML S+Y   GV  G      FP C+++V+KL  A + A+C +PI  +A+G    VC
Sbjct  91   SMLRSVYAALGVGGGPEE--VFPGCQKDVMKLLVAGVPALCNVPIPNEAAGTRG-VC 144

Sequence Alignment: 7. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 54.3 bits 332,  Expect = 1e-09
 Identities = 56/117 47%, Positives = 72/117 61%, Gaps = 7/117 5%
Query  2    GPWMCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADIS-EWPRCGALYSM 60
            G W C+PG  + V  +P CR L+K QC G QV E++ +DCC+Q+A I  EW  CGAL SM
Sbjct  17   GEW-CWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIAAIGDEWCICGALGSM 75
Query  61   LDSMYKEHGVS--EGQAGTG-AFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKD 117
              SMYKE GV+  + +A     FP CR EV+    AS+ AVC   I      DG  VC  
Sbjct  76   RGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDG--VCYW 133
Query  118  VAAY 121
            ++ Y
Sbjct  134  LSYY 137

Sequence Alignment: 8. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 54.3 bits 332,  Expect = 1e-09
 Identities = 56/117 47%, Positives = 72/117 61%, Gaps = 7/117 5%
Query  2    GPWMCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQLADIS-EWPRCGALYSM 60
            G W C+PG  + V  +P CR L+K QC G QV E++ +DCC+Q+A I  EW  CGAL SM
Sbjct  17   GEW-CWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIAAIGDEWCICGALGSM 75
Query  61   LDSMYKEHGVS--EGQAGTG-AFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKD 117
              SMYKE GV+  + +A     FP CR EV+    AS+ AVC   I      DG  VC  
Sbjct  76   RGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDG--VCYW 133
Query  118  VAAY 121
            ++ Y
Sbjct  134  LSYY 137

Sequence Alignment: 9. Allergen Name: Tri a TAI Sequence ID: P10846

 Score = 52.0 bits 317,  Expect = 2e-09
 Identities = 40/44 90%, Positives = 42/44 95%, Gaps = 0/44 0%
Query  1    SGPWMCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQ 44
            SGPWMCYPG AF+VPALPGCRP+L LQCNGSQVPEAVLRDCCQQ
Sbjct  1    SGPWMCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 48.8 bits 290,  Expect = 7e-08
 Identities = 48/106 45%, Positives = 66/106 62%, Gaps = 9/106 8%
Query  6    CYPGQAFQVPALPGCRPLLKLQCNG---SQVPEAVLRDCCQQLADISE-WPRCGALYSML 61
            C PG ++   +LP CR L++ QC G   S   E V +DCC+QLA + + W RCGAL  ML
Sbjct  39   CRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDHML 98
Query  62   DSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
              +Y+E G +E G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  99   SGIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGPGG-VC 149

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 47.4 bits 279,  Expect = 2e-07
 Identities = 46/106 43%, Positives = 62/106 58%, Gaps = 7/106 6%
Query  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVP-EAVLRDCCQQLADISE-WPRCGALYSMLDS 63
            C PG  + + +LP CR L+K QC GS    E V RDCC+QLA + + W RC A+  ML  
Sbjct  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGG 100
Query  64   MYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
            +Y+E G  + G+  +  F  CRR  ++  AAS+ A C     VD    G  VC
Sbjct  101  IYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCN----VDIPNGGGGVC 149

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 46.6 bits 273,  Expect = 3e-07
 Identities = 44/106 41%, Positives = 67/106 63%, Gaps = 10/106 9%
Query  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVPEAV----LRDCCQQLADISE-WPRCGALYSM 60
            C PG  + + +LP CR ++K QC G++ P AV     +DCC++LA + + W RC AL  M
Sbjct  41   CQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNHM 100
Query  61   LDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
            +  +Y+E G ++ G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  101  VGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 152

Sequence Alignment: 13. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 46.2 bits 270,  Expect = 4e-07
 Identities = 45/107 42%, Positives = 62/107 57%, Gaps = 9/107 8%
Query  5    MCYPGQAFQVPALPGCRPLLKLQCNG---SQVPEAVLRDCCQQLADISE-WPRCGALYSM 60
            +C PG  + +  LP CR L+K QC G   +   E V RDCC+QLA + + W RC A+  M
Sbjct  41   LCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHM 100
Query  61   LDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
            L  +Y+E G  + G+  +  F  CRR  ++  AAS+ A C     VD    G  VC
Sbjct  101  LGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCN----VDIPNGGGGVC 152

Sequence Alignment: 14. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 46.2 bits 270,  Expect = 4e-07
 Identities = 44/106 41%, Positives = 65/106 61%, Gaps = 11/106 10%
Query  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVP-----EAVLRDCCQQLADISE-WPRCGALYS 59
            C PG  + + +LP CR ++K QC G   P     E + +DCC+QLA + + W RC AL  
Sbjct  34   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 93
Query  60   MLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
            M+  +Y+E G ++ G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  94   MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 146

Sequence Alignment: 15. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 46.2 bits 270,  Expect = 4e-07
 Identities = 44/106 41%, Positives = 65/106 61%, Gaps = 11/106 10%
Query  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVP-----EAVLRDCCQQLADISE-WPRCGALYS 59
            C PG  + + +LP CR ++K QC G   P     E + +DCC+QLA + + W RC AL  
Sbjct  41   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH 100
Query  60   MLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
            M+  +Y+E G ++ G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 153

Sequence Alignment: 16. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 45.2 bits 262,  Expect = 9e-07
 Identities = 43/106 40%, Positives = 65/106 61%, Gaps = 11/106 10%
Query  6    CYPGQAFQVPALPGCRPLLKLQCNGSQVP-----EAVLRDCCQQLADISE-WPRCGALYS 59
            C PG  + + +LP CR ++K QC  +  P     E + +DCC+QLA + + W RC AL  
Sbjct  41   CQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH 100
Query  60   MLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
            M+  +Y+E G ++ G+     FP CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  101  MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PNGTGG-VC 153

Sequence Alignment: 17. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 42.4 bits 241,  Expect = 5e-06
 Identities = 44/107 41%, Positives = 60/107 56%, Gaps = 7/107 6%
Query  5    MCYPGQAFQVPALPGCRPLLKLQCNG-SQVPEAVLRDCCQQLADI-SEWPRCGALYSMLD 62
            +C PG  +    LP CR ++K QC     + E V R CC+QLA I S W RC AL  ML 
Sbjct  40   LCQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCRCDALNHMLR 99
Query  63   SMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
             +Y+E   ++ G+     F  CRR  ++  AAS+ A C + I    +G G  VC
Sbjct  100  IIYREERAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVDI---PNGVGG-VC 149

Sequence Alignment: 18. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 35.2 bits 187,  Expect = 0.0006
 Identities = 31/73 42%, Positives = 46/73 63%, Gaps = 6/73 8%
Query  39   RDCCQQLADISE-WPRCGALYSMLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASIT 96
            +DCC+QLA + + W RC AL  M+  +Y+E G ++ G+     FP CRR  ++  AAS+ 
Sbjct  26   QDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLP 85
Query  97   AVCRLPIVVDASGDGAYVC 115
            A C + I    +G G  VC
Sbjct  86   AFCNVDI---PNGTGG-VC 100

Sequence Alignment: 19. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 35.1 bits 186,  Expect = 0.0006
 Identities = 33/89 37%, Positives = 54/89 60%, Gaps = 10/89 11%
Query  23   LLKLQCNGSQ----VPEAVLRDCCQQLADISE-WPRCGALYSMLDSMYKEHGVSE-GQAG 76
            ++K QC  ++      E + +DCC+QLA + + W RC AL  M+  +Y+E G ++ G+  
Sbjct  2    VVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPM 61
Query  77   TGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
               FP CRR  ++   A++ A C + I    +G G  VC
Sbjct  62   AEVFPGCRRGDLERARATLPAFCNVDI---PNGTGG-VC 96

Sequence Alignment: 20. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 35.0 bits 185,  Expect = 0.0007
 Identities = 35/91 38%, Positives = 53/91 58%, Gaps = 11/91 12%
Query  21   RPLLKLQCNGSQVP-----EAVLRDCCQQLADISE-WPRCGALYSMLDSMYKEHGVSE-G 73
            R  +K QC  +  P     E + +DCC+QLA + + W RC AL  M+  +Y+E G ++ G
Sbjct  1    RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVG 60
Query  74   QAGTGAFPSCRREVVKLTAASITAVCRLPIVVDASGDGAYVC 115
            +     FP CRR  ++    S+ A C + I    +G G  VC
Sbjct  61   HPMAEVFPGCRRGDLERRRRSLPAFCNVDI---PNGTGG-VC 98

Sequence Alignment: 21. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 34.4 bits 181,  Expect = 0.0008
 Identities = 26/52 50%, Positives = 35/52 67%, Gaps = 4/52 7%
Query  6    CYPGQAFQVPALPGCRPLLKLQCNG---SQVPEAVLRDCCQQLADISE-WPRCGAL 57
            C PG ++   +LP CR L++ QC G   S   E V +DCC+QLA + + W RCGAL
Sbjct  39   CRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGAL 94

Sequence Alignment: 22. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 32.3 bits 164,  Expect = 0.006
 Identities = 42/99 42%, Positives = 55/99 55%, Gaps = 27/99 27%
Query  2    GPWMCYPGQAFQVPALP------GCRPLLKLQCNGSQVPE--AVLRDCCQQLADIS-EWP 52
            GP +C PG  +  P  P      G  PLL     G   P   AV  DCC+Q+  +   W 
Sbjct  39   GP-LCQPGMGY--PMYPLRVAGVGEAPLL-----GRARPRRRAVPGDCCRQFPPVDYSWC 90
Query  53   RCGALYSMLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIV--VDASG 109
            RC A+  ML  +Y+E G  + G+  +  F  CRR        + +A  R P V  VD   
Sbjct  91   RCEAISHMLGGIYRELGAPDVGHPMSEVFRGCRR-------GTWSARRRAPGVLQVDIPN 143
Query  110  DGAYVC 115
             G  VC
Sbjct  144  GGGGVC 149

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.