The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SGPWMCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ
Sequence Info Allergen Name Length Opt Bits Score E Value
P10846 Tri a TAI 44 342 80.3 2.1e-18
P01084 Tri a TAI 124 317 75.4 1.7e-16
P01085 Tri a TAI 124 309 73.7 5.7e-16
CAI84642 Tri a 28.0101 119 264 64.0 4.5e-13
P01083 Tri a TAI 123 226 55.9 1.3e-10
CBA13560 Tri a 15.0101 121 225 55.7 1.5e-10
CAA08836 Hor v 1 152 183 46.8 9.1e-08
P16968 Hor v 15.0101 146 160 41.8 2.7e-06
P16968 Hor v 1 146 160 41.8 2.7e-06
BAA01996 Ory s TAI 157 133 36.0 0.00016
BAA01999 Ory s TAI 95 122 33.5 0.00058
BAA07713 Ory s TAI 160 124 34.1 0.00061
BAA01998 Ory s TAI 165 124 34.1 0.00063
BAA01997 Ory s TAI 162 122 33.7 0.00083
BAA07711 Ory s TAI 160 121 33.5 0.00096
BAA02000 Ory s TAI 166 121 33.5 0.00098
BAA07710 Ory s TAI 166 113 31.8 0.0032
BAA07712 Ory s TAI 157 107 30.5 0.0076
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a TAI Sequence ID: P10846

 Score = 80.3 bits 342,  Expect = 2e-18
 Identities = 44/44 100%, Positives = 44/44 100%, Gaps = 0/44 0%
Query  1    SGPWMCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44
            SGPWMCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ
Sbjct  1    SGPWMCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44

Sequence Alignment: 2. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 75.4 bits 317,  Expect = 2e-16
 Identities = 40/44 90%, Positives = 42/44 95%, Gaps = 0/44 0%
Query  1    SGPWMCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44
            SGPWMCYPG AF+VPALPGCRP+L LQCNGSQVPEAVLRDCCQQ
Sbjct  1    SGPWMCYPGQAFQVPALPGCRPLLKLQCNGSQVPEAVLRDCCQQ 44

Sequence Alignment: 3. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 73.7 bits 309,  Expect = 6e-16
 Identities = 39/44 88%, Positives = 41/44 93%, Gaps = 0/44 0%
Query  1    SGPWMCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44
            SGPWMCYPG AF+VPALP CRP+L LQCNGSQVPEAVLRDCCQQ
Sbjct  1    SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQ 44

Sequence Alignment: 4. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 64.0 bits 264,  Expect = 4e-13
 Identities = 34/39 87%, Positives = 36/39 92%, Gaps = 0/39 0%
Query  6    CYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44
            CYPG AF+VPALP CRP+L LQCNGSQVPEAVLRDCCQQ
Sbjct  1    CYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQ 39

Sequence Alignment: 5. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 55.9 bits 226,  Expect = 1e-10
 Identities = 31/44 70%, Positives = 34/44 77%, Gaps = 1/44 2%
Query  1    SGPW-MCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44
            SGPW  C P   +KV AL GCR ++ LQC GSQVPEAVLRDCCQQ
Sbjct  1    SGPWSWCNPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQ 45

Sequence Alignment: 6. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 55.7 bits 225,  Expect = 2e-10
 Identities = 31/44 70%, Positives = 34/44 77%, Gaps = 1/44 2%
Query  1    SGPW-MCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44
            SGPW  C P   +KV AL GCR ++ LQC GSQVPEAVLRDCCQQ
Sbjct  1    SGPWSWCDPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQ 45

Sequence Alignment: 7. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 46.8 bits 183,  Expect = 9e-08
 Identities = 25/44 56%, Positives = 31/44 70%, Gaps = 1/44 2%
Query  1    SGPWM-CYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44
            SGPWM C P    KV  L  CR ++ L+C G++VPE VLRDCCQ+
Sbjct  31   SGPWMWCDPEMGHKVSPLTRCRALVKLECVGNRVPEDVLRDCCQE 75

Sequence Alignment: 8. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 41.8 bits 160,  Expect = 3e-06
 Identities = 19/42 45%, Positives = 28/42 66%, Gaps = 1/42 2%
Query  2    GPWMCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44
            G W C+PG  + V  +P CR ++  QC G QV E++ +DCC+Q
Sbjct  17   GEW-CWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQ 58

Sequence Alignment: 9. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 41.8 bits 160,  Expect = 3e-06
 Identities = 19/42 45%, Positives = 28/42 66%, Gaps = 1/42 2%
Query  2    GPWMCYPGYAFKVPALPGCRPVLLLQCNGSQVPEAVLRDCCQQ 44
            G W C+PG  + V  +P CR ++  QC G QV E++ +DCC+Q
Sbjct  17   GEW-CWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQ 58

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 36.0 bits 133,  Expect = 0.0002
 Identities = 18/39 46%, Positives = 24/39 61%, Gaps = 1/39 2%
Query  6    CYPGYAFKVPALPGCRPVLLLQCNGSQVP-EAVLRDCCQQ 44
            C PG  + + +LP CR ++  QC GS    E V RDCC+Q
Sbjct  41   CQPGMGYPMYSLPRCRALVKRQCRGSAAAAEQVRRDCCRQ 80

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 33.5 bits 122,  Expect = 0.0006
 Identities = 17/39 43%, Positives = 24/39 61%, Gaps = 3/39 7%
Query  6    CYPGYAFKVPALPGCRPVLLLQCNG---SQVPEAVLRDCCQQ 44
            C PG ++   +LP CR ++  QC G   S   E V +DCC+Q
Sbjct  39   CRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQ 80

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 34.1 bits 124,  Expect = 0.0006
 Identities = 17/40 42%, Positives = 24/40 60%, Gaps = 3/40 7%
Query  5    MCYPGYAFKVPALPGCRPVLLLQCNG---SQVPEAVLRDCCQQ 44
            +C PG  + +  LP CR ++  QC G   +   E V RDCC+Q
Sbjct  41   LCQPGMGYPMYPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQ 83

Sequence Alignment: 13. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 34.1 bits 124,  Expect = 0.0006
 Identities = 17/39 43%, Positives = 26/39 66%, Gaps = 4/39 10%
Query  6    CYPGYAFKVPALPGCRPVLLLQCNGSQVPEAV----LRDCCQQ 44
            C PG  + + +LP CR V+  QC G++ P AV     +DCC++
Sbjct  41   CQPGMGYPMYSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRE 83

Sequence Alignment: 14. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 33.7 bits 122,  Expect = 0.0008
 Identities = 17/39 43%, Positives = 24/39 61%, Gaps = 3/39 7%
Query  6    CYPGYAFKVPALPGCRPVLLLQCNG---SQVPEAVLRDCCQQ 44
            C PG ++   +LP CR ++  QC G   S   E V +DCC+Q
Sbjct  39   CRPGISYPTYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQ 80

Sequence Alignment: 15. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 33.5 bits 121,  Expect = 0.001
 Identities = 17/39 43%, Positives = 24/39 61%, Gaps = 5/39 12%
Query  6    CYPGYAFKVPALPGCRPVLLLQCNGSQVP-----EAVLRDCCQQ 44
            C PG  + + +LP CR V+  QC G   P     E + +DCC+Q
Sbjct  34   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQ 77

Sequence Alignment: 16. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 33.5 bits 121,  Expect = 0.001
 Identities = 17/39 43%, Positives = 24/39 61%, Gaps = 5/39 12%
Query  6    CYPGYAFKVPALPGCRPVLLLQCNGSQVP-----EAVLRDCCQQ 44
            C PG  + + +LP CR V+  QC G   P     E + +DCC+Q
Sbjct  41   CQPGMGYPMYSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQ 84

Sequence Alignment: 17. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 31.8 bits 113,  Expect = 0.003
 Identities = 16/39 41%, Positives = 24/39 61%, Gaps = 5/39 12%
Query  6    CYPGYAFKVPALPGCRPVLLLQCNGSQVP-----EAVLRDCCQQ 44
            C PG  + + +LP CR V+  QC  +  P     E + +DCC+Q
Sbjct  41   CQPGMGYPMYSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQ 84

Sequence Alignment: 18. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 30.5 bits 107,  Expect = 0.008
 Identities = 15/40 37%, Positives = 20/40 50%, Gaps = 1/40 2%
Query  5    MCYPGYAFKVPALPGCRPVLLLQCNG-SQVPEAVLRDCCQQ 44
            +C PG  +    LP CR  +  QC     + E V R CC+Q
Sbjct  40   LCQPGIGYPTYPLPRCRAFVKRQCVAPGTLDEQVRRGCCRQ 80

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.