The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SMTDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCT
IELKFMVLLKKDHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGS
IMIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPS
GRLTKSSVSFAHS
Sequence Info Allergen Name Length Opt Bits Score E Value
D5MU14 Onc k 5.0101 193 1297 302.6 5e-84
CAA31942 Gal d vitellogenin 1850 464 112.4 8.3e-26
AAA49139 Gal d vitellogenin 1852 464 112.4 8.3e-26
P87498 gal d 6.0101 1912 328 81.4 1.8e-16
P87498 Gal d 6.0101 1912 328
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Onc k 5.0101 Sequence ID: D5MU14

 Score = 302.6 bits 1297,  Expect = 5e-84
 Identities = 193/193 100%, Positives = 193/193 100%, Gaps = 0/193 0%
Query  1    SMTDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCT 60
            SMTDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCT
Sbjct  1    SMTDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCT 60
Query  61   IELKFMVLLKKDHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGS 120
            IELKFMVLLKKDHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGS
Sbjct  61   IELKFMVLLKKDHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGS 120
Query  121  IMIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPS 180
            IMIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPS
Sbjct  121  IMIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPS 180
Query  181  GRLTKSSVSFAHS 193
            GRLTKSSVSFAHS
Sbjct  181  GRLTKSSVSFAHS 193

Sequence Alignment: 2. Allergen Name: Gal d vitellogenin Sequence ID: CAA31942

 Score = 112.4 bits 464,  Expect = 8e-26
 Identities = 70/191 36%, Positives = 111/191 58%, Gaps = 1/191 0%
Query  3    TDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCTIE 62
            ++L P   N+  +      E    +CS+  + + TFN  K+  +MP +CY++L QDC+ E
Sbjct  1556 SELQPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSE 1615
Query  63   LKFMVLLKK-DHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGSI 121
            LKF+V++K    A+    IN+KI   ++D++  +  V + V+  E    N+       S+
Sbjct  1616 LKFLVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASL 1675
Query  122  MIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPSG 181
             I  + +G +L A  HG+ ++YFD  +  I+V  WM G+TCG+CGK D E  QEYR P+G
Sbjct  1676 WIHNENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNG 1735
Query  182  RLTKSSVSFAHS 193
             L K++VSF HS
Sbjct  1736 YLAKNAVSFGHS 1747

Sequence Alignment: 3. Allergen Name: Gal d vitellogenin Sequence ID: AAA49139

 Score = 112.4 bits 464,  Expect = 8e-26
 Identities = 70/191 36%, Positives = 111/191 58%, Gaps = 1/191 0%
Query  3    TDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCTIE 62
            ++L P   N+  +      E    +CS+  + + TFN  K+  +MP +CY++L QDC+ E
Sbjct  1558 SELQPPIWNVFAEAPSAVLENLKARCSVSYNKIKTFNEVKFNYSMPANCYHILVQDCSSE 1617
Query  63   LKFMVLLKK-DHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGSI 121
            LKF+V++K    A+    IN+KI   ++D++  +  V + V+  E    N+       S+
Sbjct  1618 LKFLVMMKSAGEATNLKAINIKIGSHEIDMHPVNGQVKLLVDGAESPTANISLISAGASL 1677
Query  122  MIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPSG 181
             I  + +G +L A  HG+ ++YFD  +  I+V  WM G+TCG+CGK D E  QEYR P+G
Sbjct  1678 WIHNENQGFALAAPGHGIDKLYFDGKTITIQVPLWMAGKTCGICGKYDAECEQEYRMPNG 1737
Query  182  RLTKSSVSFAHS 193
             L K++VSF HS
Sbjct  1738 YLAKNAVSFGHS 1749

Sequence Alignment: 4. Allergen Name: gal d 6.0101 Sequence ID: P87498

 Score = 81.4 bits 328,  Expect = 2e-16
 Identities = 54/183 29%, Positives = 91/183 49%, Gaps = 2/183 1%
Query  11   NIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCTIELKFMVLLK 70
            N + +I    ++ +   C +    + TF+   +  +   SC  V+AQDCT   KF++  +
Sbjct  1625 NFLPEIASQIAQEDQSTCEVSKGDFKTFDRMSFTCSFNKSCNVVVAQDCTEHPKFIITTR 1684
Query  71   K-DHASEQNHINVKISDIDVDLY-TEDHGVMVKVNEMEISKDNLPYTDPSGSIMIKQKGE 128
            K DH S    +++  S  ++ +    D  ++V  N+  +  D+        +I I + G+
Sbjct  1685 KVDHQSLSREVHINTSSANITICPAADSSLLVTCNKESVLSDSGVSEYEKDNIKIYKNGK 1744
Query  129  GVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPSGRLTKSSV 188
             V + A  HGL+ V FD    K+ V  WM+G+TCG+CG  D E   E   P+ +L  S  
Sbjct  1745 TVIVEAPIHGLKNVNFDGEILKVTVASWMRGKTCGVCGNNDREKHNELLMPNHKLAHSCS 1804
Query  189  SFAHS 193
            +F HS
Sbjct  1805 AFVHS 1809

Sequence Alignment: 5. Allergen Name: Gal Sequence ID: P87498

 Score = 81.4 bits 328,  Expect = 2e-16
 Identities = 54/183 29%, Positives = 91/183 49%, Gaps = 2/183 1%
Query  11   NIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCTIELKFMVLLK 70
            N + +I    ++ +   C +    + TF+   +  +   SC  V+AQDCT   KF++  +
Sbjct  1625 NFLPEIASQIAQEDQSTCEVSKGDFKTFDRMSFTCSFNKSCNVVVAQDCTEHPKFIITTR 1684
Query  71   K-DHASEQNHINVKISDIDVDLY-TEDHGVMVKVNEMEISKDNLPYTDPSGSIMIKQKGE 128
            K DH S    +++  S  ++ +    D  ++V  N+  +  D+        +I I + G+
Sbjct  1685 KVDHQSLSREVHINTSSANITICPAADSSLLVTCNKESVLSDSGVSEYEKDNIKIYKNGK 1744
Query  129  GVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPSGRLTKSSV 188
             V + A  HGL+ V FD    K+ V  WM+G+TCG+CG  D E   E   P+ +L  S  
Sbjct  1745 TVIVEAPIHGLKNVNFDGEILKVTVASWMRGKTCGVCGNNDREKHNELLMPNHKLAHSCS 1804
Query  189  SFAHS 193
            +F HS
Sbjct  1805 AFVHS 1809

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.