The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ
NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL
KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI
RALFGLTH
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD13532 Bla g 1.0103 188 1193 278.9 6.4e-77
AAD13530 Bla g 1.0101 412 1193 278.6 1.7e-76
AAD13531 Bla g 1.02 492 965 226.7 8.9e-61
AAC34312 Per a 1.0102 228 867 204.5 1.9e-54
AAD13533 Per a 1.0101 231 865 204.0 2.7e-54
AAB82404 Per a 1.0103 395 858 202.3 1.5e-53
AAC34737 Per a 1.0104 274 841 198.5 1.5e-52
AAC34736 Per a 1.0201 446 650 154.9 3.3e-39
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bla g 1.0103 Sequence ID: AAD13532

 Score = 278.9 bits 1193,  Expect = 6e-77
 Identities = 188/188 100%, Positives = 188/188 100%, Gaps = 0/188 0%
Query  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
            SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ
Sbjct  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
Query  61   NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL 120
            NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL
Sbjct  61   NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL 120
Query  121  KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI 180
            KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI
Sbjct  121  KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI 180
Query  181  RALFGLTH 188
            RALFGLTH
Sbjct  181  RALFGLTH 188

Sequence Alignment: 2. Allergen Name: Bla g 1.0101 Sequence ID: AAD13530

 Score = 278.6 bits 1193,  Expect = 2e-76
 Identities = 188/188 100%, Positives = 188/188 100%, Gaps = 0/188 0%
Query  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
            SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ
Sbjct  225  SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 284
Query  61   NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL 120
            NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL
Sbjct  285  NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL 344
Query  121  KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI 180
            KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI
Sbjct  345  KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI 404
Query  181  RALFGLTH 188
            RALFGLTH
Sbjct  405  RALFGLTH 412
 Score = 271.6 bits 1162,  Expect = 2e-74
 Identities = 182/187 97%, Positives = 186/187 99%, Gaps = 0/187 0%
Query  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
            SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVV LDALPELQ
Sbjct  33   SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVALDALPELQ 92
Query  61   NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL 120
            NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILP++DL
Sbjct  93   NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPIEDL 152
Query  121  KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI 180
            KALFNEKLETSPDFLALYNAI+SPEFQSIVQTLNAMPEYQNLL+KLREKGVDVDKIIELI
Sbjct  153  KALFNEKLETSPDFLALYNAIRSPEFQSIVQTLNAMPEYQNLLQKLREKGVDVDKIIELI 212
Query  181  RALFGLT 187
            RALFGLT
Sbjct  213  RALFGLT 219

Sequence Alignment: 3. Allergen Name: Bla g 1.02 Sequence ID: AAD13531

 Score = 226.7 bits 965,  Expect = 9e-61
 Identities = 143/187 76%, Positives = 172/187 91%, Gaps = 1/187 0%
Query  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
            +R L +DLQDFLALIP+DQI+AIA DYLANDAEVQAAV YL+SDEFETIVVT+D+LPE++
Sbjct  306  TRGLPEDLQDFLALIPIDQILAIAADYLANDAEVQAAVEYLKSDEFETIVVTVDSLPEFK 365
Query  61   NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL 120
            NFLNFL+ NGLNAI+F+N IHDLLGIPHIP +GRK H+RRGVGI GLIDDV+AILP+D+L
Sbjct  366  NFLNFLQTNGLNAIEFINNIHDLLGIPHIPATGRK-HVRRGVGINGLIDDVIAILPVDEL 424
Query  121  KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI 180
             ALF EKLE+SP+F ALY+AI+SPEFQSIVQTL AMPEYQ+L+++L++KGVDVD  IELI
Sbjct  425  YALFQEKLESSPEFKALYDAIRSPEFQSIVQTLKAMPEYQDLIQRLKDKGVDVDHFIELI 484
Query  181  RALFGLTH 188
            + LFGL+H
Sbjct  485  KKLFGLSH 492
 Score = 222.6 bits 947,  Expect = 2e-59
 Identities = 142/185 76%, Positives = 170/185 91%, Gaps = 1/185 0%
Query  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
            +R L +DLQDFLALIP DQ++AIA DYLANDAEV+AAV YL+SDEFETIVVT+D+LPE++
Sbjct  118  TRGLPEDLQDFLALIPTDQVLAIAADYLANDAEVKAAVEYLKSDEFETIVVTVDSLPEFK 177
Query  61   NFLNFLEANGLNAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL 120
            NFLNFL+ NGLNAI+FLN IHDLLGIPHIPV+GRK H+RRGVGITGLIDD++AILP+DDL
Sbjct  178  NFLNFLQTNGLNAIEFLNNIHDLLGIPHIPVTGRK-HLRRGVGITGLIDDIIAILPVDDL 236
Query  121  KALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELI 180
             ALF EKLETSP+F ALY+AI+SPEFQSIV+TL AMPEYQ+L++KL++KGVDVD IIELI
Sbjct  237  YALFQEKLETSPEFKALYDAIRSPEFQSIVETLKAMPEYQSLIQKLKDKGVDVDHIIELI 296
Query  181  RALFGL 186
              +F +
Sbjct  297  HQIFNI 302
 Score = 139.4 bits 582,  Expect = 2e-34
 Identities = 88/114 77%, Positives = 103/114 90%, Gaps = 1/114 0%
Query  72   NAIDFLNGIHDLLGIPHIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETS 131
            NAI+FLN IHDLLGIPHIPV+ RK+H RRGVGITGLIDD++AILP+DDL ALF EKLETS
Sbjct  1    NAIEFLNNIHDLLGIPHIPVTARKHH-RRGVGITGLIDDIIAILPVDDLYALFQEKLETS 59
Query  132  PDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGL 186
            P+F ALY+AI+SPEFQSIV TL AMPEYQNL++KL++KGVDVD IIELI  +F +
Sbjct  60   PEFKALYDAIRSPEFQSIVGTLEAMPEYQNLIQKLKDKGVDVDHIIELIHQIFNI 114

Sequence Alignment: 4. Allergen Name: Per a 1.0102 Sequence ID: AAC34312

 Score = 204.5 bits 867,  Expect = 2e-54
 Identities = 133/184 72%, Positives = 158/184 85%, Gaps = 3/184 1%
Query  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
            +RNLQDDL DFLALIP DQI+AIA DYLANDAEVQ  VAYLQSD+F  I+ T++ LPE+ 
Sbjct  43   ARNLQDDLNDFLALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIITTIEGLPEFA 102
Query  61   NFLNFLEANGLNAIDFLNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPLDD 119
            NF NFL+ +GL+  DFLN IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+D+
Sbjct  103  NFYNFLKEHGLDVADFLNEIHSIIGLPPFVPPSRR--HARRGVGINGLIDDVIAILPVDE 160
Query  120  LKALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIEL 179
            LKALF+EKLETSPDF ALY+AI+SPEFQSI+ TLNAMPEYQ+LL+ LR+KGVDVD  IEL
Sbjct  161  LKALFDEKLETSPDFKALYDAIRSPEFQSIISTLNAMPEYQDLLQNLRDKGVDVDHFIEL 220
Query  180  IRALFGL 186
            IR+LFGL
Sbjct  221  IRSLFGL 227
 Score = 53.6 bits 205,  Expect = 5e-09
 Identities = 32/40 80%, Positives = 36/40 90%, Gaps = 0/40 0%
Query  148  SIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGLT 187
            SI+ TLNAMPEYQ+LL+ LR+KGVDVD  IELIRALFGLT
Sbjct  1    SIISTLNAMPEYQDLLQNLRDKGVDVDHYIELIRALFGLT 40

Sequence Alignment: 5. Allergen Name: Per a 1.0101 Sequence ID: AAD13533

 Score = 204.0 bits 865,  Expect = 3e-54
 Identities = 133/184 72%, Positives = 157/184 85%, Gaps = 3/184 1%
Query  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
            +RNLQDDL DFLALIP DQI+AIA DYLANDAEVQ  VAYLQSD+F  I+ T++ LPE+ 
Sbjct  46   ARNLQDDLNDFLALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIITTIEGLPEFA 105
Query  61   NFLNFLEANGLNAIDFLNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPLDD 119
            NF NFL+ +GL+  DFLN IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+D+
Sbjct  106  NFYNFLKEHGLDVADFLNEIHSIIGLPPFVPPSRR--HARRGVGINGLIDDVIAILPVDE 163
Query  120  LKALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIEL 179
            LKALF EKLETSPDF ALY+AI+SPEFQSI+ TLNAMPEYQ+LL+ LR+KGVDVD  IEL
Sbjct  164  LKALFQEKLETSPDFKALYDAIRSPEFQSIISTLNAMPEYQDLLQNLRDKGVDVDHFIEL 223
Query  180  IRALFGL 186
            IR+LFGL
Sbjct  224  IRSLFGL 230
 Score = 57.9 bits 224,  Expect = 3e-10
 Identities = 35/43 81%, Positives = 38/43 88%, Gaps = 0/43 0%
Query  145  EFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGLT 187
            EFQSI+ TLNAMPEYQ LL+ LR+KGVDVD  IELIRALFGLT
Sbjct  1    EFQSIISTLNAMPEYQELLQNLRDKGVDVDHYIELIRALFGLT 43

Sequence Alignment: 6. Allergen Name: Per a 1.0103 Sequence ID: AAB82404

 Score = 202.3 bits 858,  Expect = 2e-53
 Identities = 131/186 70%, Positives = 160/186 86%, Gaps = 2/186 1%
Query  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
            +RNLQDDL DFLAL+PVD+I AI  DYLANDAEVQ AVAYLQ +EF  IV T++ L E+ 
Sbjct  21   NRNLQDDLNDFLALLPVDEITAIVMDYLANDAEVQEAVAYLQGEEFHKIVFTVEGLQEFG 80
Query  61   NFLNFLEANGLNAIDFLNGIHDLLGI-PHIPVSGRKYHIRRGVGITGLIDDVLAILPLDD 119
            NF+ FLE +GL+A+ ++N +H ++G  P++P S RK H RRGVG+ GLIDD++AILP+DD
Sbjct  81   NFVQFLEDHGLDAVGYINRLHSVFGWDPYVPSSKRK-HTRRGVGVDGLIDDIIAILPIDD 139
Query  120  LKALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIEL 179
            LKALF EKLETSPDF A+Y+A++SPEFQSIVQTLNAMPEYQ+LL+KLR+KGVDVD  IEL
Sbjct  140  LKALFQEKLETSPDFKAFYDAVRSPEFQSIVQTLNAMPEYQDLLQKLRDKGVDVDHYIEL 199
Query  180  IRALFGLT 187
            IRALFGLT
Sbjct  200  IRALFGLT 207
 Score = 200.7 bits 851,  Expect = 5e-53
 Identities = 131/184 71%, Positives = 156/184 84%, Gaps = 3/184 1%
Query  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
            +RNLQDDL DFLALIP DQI+AIA DYLANDAEVQ  VAYLQSD+F  I+ T++ALPE+ 
Sbjct  210  ARNLQDDLNDFLALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIINTIEALPEFA 269
Query  61   NFLNFLEANGLNAIDFLNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPLDD 119
            NF NFL+ +GL+  D++N IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+D+
Sbjct  270  NFYNFLKGHGLDVADYINEIHSIIGLPPFVPPSRR--HARRGVGINGLIDDVIAILPVDE 327
Query  120  LKALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIEL 179
            LKALF EKLETSPDF ALY+AI+SPEFQSI+ TLNAMPEYQ LL+ LR+K VDVD  IEL
Sbjct  328  LKALFQEKLETSPDFKALYDAIRSPEFQSIISTLNAMPEYQELLQNLRDKAVDVDHFIEL 387
Query  180  IRALFGL 186
            IR+LFGL
Sbjct  388  IRSLFGL 394

Sequence Alignment: 7. Allergen Name: Per a 1.0104 Sequence ID: AAC34737

 Score = 198.5 bits 841,  Expect = 1e-52
 Identities = 129/184 70%, Positives = 155/184 84%, Gaps = 3/184 1%
Query  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
            +RNLQDDL DFLALIP DQI+AIA DYLANDAEVQ  VAYLQSD+F  I+ T++ALPE+ 
Sbjct  89   ARNLQDDLNDFLALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIINTIEALPEFA 148
Query  61   NFLNFLEANGLNAIDFLNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPLDD 119
            NF NFL+ +GL+  +++N IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+D+
Sbjct  149  NFYNFLKGHGLDVANYINEIHSIIGLPPFVPPSRR--HARRGVGINGLIDDVIAILPVDE 206
Query  120  LKALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIEL 179
            LK LF EKLETSPDF ALY+AI+SPEFQSI+ TLNAMPEYQ LL+ LR+KGVDVD  IEL
Sbjct  207  LKTLFQEKLETSPDFKALYDAIRSPEFQSIISTLNAMPEYQELLQNLRDKGVDVDHFIEL 266
Query  180  IRALFGL 186
            IR+ FGL
Sbjct  267  IRSWFGL 273
 Score = 110.1 bits 453,  Expect = 6e-26
 Identities = 69/86 80%, Positives = 80/86 93%, Gaps = 0/86 0%
Query  102  VGITGLIDDVLAILPLDDLKALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQN 161
            VG+ GLIDD++AILP+DDLKALF EKLETS DF A+Y+A++SPEFQSIVQTLNAMPEYQ+
Sbjct  1    VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD 60
Query  162  LLEKLREKGVDVDKIIELIRALFGLT 187
            LL+KLR+KGVDVD  IELIRALFGLT
Sbjct  61   LLQKLRDKGVDVDHYIELIRALFGLT 86

Sequence Alignment: 8. Allergen Name: Per a 1.0201 Sequence ID: AAC34736

 Score = 154.9 bits 650,  Expect = 3e-39
 Identities = 106/174 60%, Positives = 135/174 77%, Gaps = 8/174 4%
Query  1    SRNLQDDLQDFL-ALIPVDQIIAIATDYLANDAEVQAAV-AYLQSDEFETIVVTLDALPE 58
            +RNLQDDL DFL +L P+          L       A V AYL++D+F  I+ T++ALPE
Sbjct  112  ARNLQDDLNDFLHSLEPISP---RHRHGLPRQRRRSARVSAYLHADDFHKIITTIEALPE 168
Query  59   LQNFLNFLEANGLNAIDFLNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPL 117
            + NF NFL+ +GL+ +D++N IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+
Sbjct  169  FANFYNFLKEHGLDVVDYINEIHSIIGLPPFVPPSRR--HARRGVGINGLIDDVIAILPV 226
Query  118  DDLKALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKII 177
            D+LKALF EKLETSPDF ALY+AI+SPEFQSI+ TLNAMPEYQ LL+ LR+KGVDVD  I
Sbjct  227  DELKALFQEKLETSPDFKALYDAIRSPEFQSIISTLNAMPEYQELLQNLRDKGVDVDHFI 286
Query  178  EL 179
             +
Sbjct  287  RV 288
 Score = 150.8 bits 632,  Expect = 6e-38
 Identities = 97/138 70%, Positives = 117/138 84%, Gaps = 3/138 2%
Query  2    RNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQN 61
            RNLQDDL DFLALIP DQI+AIA DYLANDAEVQ  VAYLQSD+F  I+ T++ALPE+ N
Sbjct  301  RNLQDDLNDFLALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIITTIEALPEFAN 360
Query  62   FLNFLEANGLNAIDFLNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPLDDL 120
            F NFL+ +GL+ +D++N IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+D+L
Sbjct  361  FYNFLKEHGLDVVDYINEIHSIIGLPPFVPPSQR--HARRGVGINGLIDDVIAILPVDEL 418
Query  121  KALFNEKLETSPDFLALYNAI 141
            KALF EKLETSPDF ALY+AI
Sbjct  419  KALFQEKLETSPDFKALYDAI 439
 Score = 111.3 bits 459,  Expect = 4e-26
 Identities = 74/108 68%, Positives = 91/108 84%, Gaps = 4/108 3%
Query  77   LNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFL 135
            +N IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+D+LKALF EKLETSPDF 
Sbjct  1    INEIHSIIGLPPFVPPSRR--HARRGVGINGLIDDVIAILPVDELKALFQEKLETSPDFK 58
Query  136  ALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGLT 187
            ALY+AI+SPEFQSI+ TLNAM   ++  + LR+KGVDVD  I+LIRALFGL+
Sbjct  59   ALYDAIRSPEFQSIISTLNAMQRSEHH-QNLRDKGVDVDHFIQLIRALFGLS 109

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.