The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL
PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL
DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQH
RRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF
GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN
ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGI
NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE
Sequence Info Allergen Name Length Opt Bits Score E Value
CAD87730 Len c 1.0101 418 2675 616.1 9.8e-178
CAD87731 Len c 1.0102 415 2514 579.4 1.1e-166
CAF25232 Pis s 1.0101 415 2422 558.4 2.2e-160
CAF25233 Pis s 1.0102 415 2406 554.8 2.8e-159
ACB05815 Lup an 1.0101 611 1616 374.6 7e-105
P43238 Ara h 1 626 1513 351.1 8.4e-98
P43237 Ara h 1 614 1501 348.4 5.5e-97
Q9FZP9 Gly m 5.0201 559 1196 278.9 4.2e-76
O22120 Gly m 5.0101 543 1178 274.8 7e-75
CAA35691 Gly m conglycinin 605 1178 274.8 7.9e-75
B1NPN8 Vig r 2.0201 454 1170 273.0 2e-74
Q198W3 Vig r 2.0101 453 1150 268.5 4.7e-73
AAB01374 Gly m conglycinin 639 850 200.0 2.7e-52
AAB23463 Gly m conglycinin 439 694 164.5 8.9e-42
P09801 Gos h 1 588 582 138.9 6e-34
P09799 Gos h 2 605 563 134.6 1.3e-32
Q9SPL3 Mac i 1.0101 625 480 115.7 6.4e-27
AAL86739 Cor a 11 448 470 113.5 2.1e-26
Q9SPL4 Mac i 1.0201 666 472 113.8 2.4e-26
AAA33947 Gly m conglycinin 218 451 109.4 1.7e-25
B3STU4 Car i 2.0101 792 457 110.4 3.2e-25
AAM54366 Jug n 2 481 451 109.1 4.7e-25
A0A2I4E5L6 Jug r 6.0101 502 449 108.6 6.7e-25
AAF18269 Jug r 2 593 446 107.9 1.3e-24
AAK15089 Ses i 3 585 433 105.0 1e-23
EF116865 Pis v 3.0101 519 423 102.7 4.3e-23
AAM73729 Ana o 1.0102 536 407 99.1 5.5e-22
AAM73730 Ana o 1.0101 538 407 99.1 5.6e-22
V9VGU0 Pin k 2.0101 463 380 92.9 3.3e-20
BAB21619 Gly m Bd28K 473 305 75.8 4.8e-15
A0A0S3B0K0 Coc n 1.0101 490 258 65.1 8.4e-12
QYU76044 Zan b 2.02 383 151 40.8 0.00014
Q9XHP0 Ses i 6.0101 459 134 36.9 0.0025
P13744 Cuc ma 4.0101 480 130 35.9 0.005
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Len c 1.0101 Sequence ID: CAD87730

 Score = 616.1 bits 2675,  Expect = 1e-177
 Identities = 418/418 100%, Positives = 418/418 100%, Gaps = 0/418 0%
Query  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL 60
            SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL
Sbjct  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL 60
Query  61   PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
            PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQH 180
            DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQH
Sbjct  121  DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQH 180
Query  181  RRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
            RRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF
Sbjct  181  RRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN 300
            GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN
Sbjct  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN 300
Query  301  ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGI 360
            ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGI
Sbjct  301  ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGI 360
Query  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418
            NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE
Sbjct  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418

Sequence Alignment: 2. Allergen Name: Len c 1.0102 Sequence ID: CAD87731

 Score = 579.4 bits 2514,  Expect = 1e-166
 Identities = 390/415 93%, Positives = 408/415 98%, Gaps = 3/415 0%
Query  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL 60
            SRSDQENPFIFKSNRFQTIYENENGHIRLLQ+FDKRSKIFENLQNYRLLEYKSKPHT+FL
Sbjct  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
Query  61   PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
            PQ+TDADFILVVLSGKA+LTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQYTDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQH 180
            DLAIPVN PGQL+SFLLSGTQNQPSFLSGF+K+ILEAAFNT+YEEIEKVLLE+QEQ+ QH
Sbjct  121  DLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDYEEIEKVLLEDQEQEPQH 180
Query  181  RRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
            RRSLRD+RQEI  E+VIVKVSREQI+ELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF
Sbjct  181  RRSLRDRRQEINKENVIVKVSREQIKELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN 300
            GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKG FELVGQRN
Sbjct  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRN 300
Query  301  ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGI 360
            ENQ   REEND+EE QEEET+ QVQRYRA+LSPGDV+V+PAGHPVAINASSDLNLIGFGI
Sbjct  301  ENQ---REENDDEEEQEEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGI 357
Query  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418
            NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE
Sbjct  358  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 415

Sequence Alignment: 3. Allergen Name: Pis s 1.0101 Sequence ID: CAF25232

 Score = 558.4 bits 2422,  Expect = 2e-160
 Identities = 377/415 90%, Positives = 399/415 96%, Gaps = 3/415 0%
Query  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL 60
            SRSDQENPFIFKSNRFQT+YENENGHIRLLQ+FDKRSKIFENLQNYRLLEYKSKPHT+FL
Sbjct  1    SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFL 60
Query  61   PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
            PQ+TDADFILVVLSGKA LTVL SNDRNSFNLERGD IKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQYTDADFILVVLSGKATLTVLKSNDRNSFNLERGDAIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQH 180
            DLAIPVN+PGQLQSFLLSGTQNQPS+LSGFSKNILEAAFNT YEEIEKVLLE+QEQ+ QH
Sbjct  121  DLAIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
Query  181  RRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
            RRSL+D+RQEI  E+VIVKVSREQIEELSKNAKSSSKKSVSSES PFNLRSRNPIYSNKF
Sbjct  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN 300
            GKFFEITPEKN QLQDLDIFVNSV+IKEGSLLLPNYNSRAIVIVTV EGKGDFELVGQRN
Sbjct  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
Query  301  ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGI 360
            ENQ +   END+EE QEEET+KQVQ YRA+LSPGDV+VIPAGHPVAINASSDLNLIGFGI
Sbjct  301  ENQGK---ENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGI 357
Query  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418
            NA+NN+RNFLAGEEDNVISQ++RPVKELAFPGSS EVDRLL NQKQS+FANAQPLQ E
Sbjct  358  NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 4. Allergen Name: Pis s 1.0102 Sequence ID: CAF25233

 Score = 554.8 bits 2406,  Expect = 3e-159
 Identities = 376/415 90%, Positives = 397/415 95%, Gaps = 3/415 0%
Query  1    SRSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL 60
            SRSDQENPFIFKSNRFQT+YENENGHIRLLQ+FDKRSKIFENLQNYRLLEYKSKP T+FL
Sbjct  1    SRSDQENPFIFKSNRFQTLYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPRTLFL 60
Query  61   PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
            PQ TDADFILVVLSGKA LTVL SNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL
Sbjct  61   PQCTDADFILVVLSGKATLTVLKSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
Query  121  DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQH 180
            DL IPVN+PGQLQSFLLSGTQNQPS+LSGFSKNILEAAFNT YEEIEKVLLE+QEQ+ QH
Sbjct  121  DLTIPVNKPGQLQSFLLSGTQNQPSLLSGFSKNILEAAFNTNYEEIEKVLLEQQEQEPQH 180
Query  181  RRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKF 240
            RRSL+D+RQEI  E+VIVKVSREQIEELSKNAKSSSKKSVSSES PFNLRSRNPIYSNKF
Sbjct  181  RRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESGPFNLRSRNPIYSNKF 240
Query  241  GKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRN 300
            GKFFEITPEKN QLQDLDIFVNSV+IKEGSLLLPNYNSRAIVIVTV EGKGDFELVGQRN
Sbjct  241  GKFFEITPEKNQQLQDLDIFVNSVDIKEGSLLLPNYNSRAIVIVTVTEGKGDFELVGQRN 300
Query  301  ENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGI 360
            ENQ +   END+EE QEEET+KQVQ YRA+LSPGDV+VIPAGHPVAINASSDLNLIGFGI
Sbjct  301  ENQGK---ENDKEEEQEEETSKQVQLYRAKLSPGDVFVIPAGHPVAINASSDLNLIGFGI 357
Query  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418
            NA+NN+RNFLAGEEDNVISQ++RPVKELAFPGSS EVDRLL NQKQS+FANAQPLQ E
Sbjct  358  NAENNERNFLAGEEDNVISQVERPVKELAFPGSSHEVDRLLKNQKQSYFANAQPLQRE 415

Sequence Alignment: 5. Allergen Name: Lup an 1.0101 Sequence ID: ACB05815

 Score = 374.6 bits 1616,  Expect = 7e-105
 Identities = 246/409 60%, Positives = 331/409 80%, Gaps = 11/409 2%
Query  1    SRSD---QENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHT 57
            SRSD   Q NP+ F SNRFQT Y N NG+IR+L+RF++R+  +ENLQNYR++E++SKP+T
Sbjct  175  SRSDSRRQRNPYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPNT 234
Query  58   IFLPQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDL 117
            + LP+ +DADFILVVL+G+A +T++N + R  +NLE+GD ++LPAGT +Y+ N DDN++L
Sbjct  235  LILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTSYILNPDDNQNL 294
Query  118  RVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQE-Q 176
            RV  LAIP+N PG+L  F  S T++Q S++SGFSKN LEA FNT YEEIE+VLL + E Q
Sbjct  295  RVAKLAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLEATFNTRYEEIERVLLGDDELQ 354
Query  177  KSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIY 236
            +++ +R  R + Q   +E VIV+VS++QI+EL K+A+SSS +   SES PFNLRS  PIY
Sbjct  355  ENEKQR--RGQEQSHQDEGVIVRVSKKQIQELRKHAQSSSGEGKPSESGPFNLRSNKPIY 412
Query  237  SNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELV 296
            SNKFG F+EITP+ NPQ+QDL+I +   EI EG+LLLP+YNS+AI IV V+EG+G++ELV
Sbjct  413  SNKFGNFYEITPDINPQFQDLNISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELV 472
Query  297  GQRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLI 356
            G R++ +Q+  +E + E+G+EE     V+RY  +LS GDV++IPAGHP++INASS+L L+
Sbjct  473  GIRDQQRQQDEQEEEYEQGEEE-----VRRYSDKLSKGDVFIIPAGHPLSINASSNLRLL 527
Query  357  GFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQ 416
            GFGINA  NQRNFLAG EDNVI Q+ R VKEL FPGS  +V+RL+ NQ+QS+FANAQP Q
Sbjct  528  GFGINANENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFANAQPQQ 587

Sequence Alignment: 6. Allergen Name: Ara h 1 Sequence ID: P43238

 Score = 351.1 bits 1513,  Expect = 8e-98
 Identities = 228/409 55%, Positives = 320/409 78%, Gaps = 13/409 3%
Query  3    SDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQ 62
            + + NPF F S RF T Y N+NG IR+LQRFD+RS+ F+NLQN+R+++ ++KP+T+ LP+
Sbjct  169  TSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTLVLPK 228
Query  63   FTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDL 122
              DAD ILV+  G+A +TV N N+R SFNL+ G  +++P+G I+Y+ NR DN++LRV  +
Sbjct  229  HADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKI 288
Query  123  AIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEE-----QEQK 177
            ++PVN PGQ++ F+ + +++Q S+L GFS+N LEAAFN E+ EI +VLLEE     QE++
Sbjct  289  SMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEER 348
Query  178  SQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE---PFNLRSRNP 234
             Q R S R       NE VIVKVS+E++EEL+K+AKS SKK    E +   P NLR   P
Sbjct  349  GQRRWSTRSSE---NNEGVIVKVSKEHVEELTKHAKSVSKKGSEEEGDITNPINLREGEP 405
Query  235  IYSNKFGKFFEITPEK-NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDF 293
              SN FGK+FE+ P+K NPQLQDLD+ +  VEIKEG+L+LP++NS+A+VIV VN+G G++
Sbjct  406  DLSNNFGKLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNL 465
Query  294  ELVGQRNENQQEQREENDEEEGQEEE-TTKQVQRYRARLSPGDVLVIPAGHPVAINASSD 352
            ELV  R E QQ  R E +E+E +EEE + ++V+RY ARL  GDV+++PA HPVAINASS+
Sbjct  466  ELVAVRKEQQQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSE 525
Query  353  LNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANA 412
            L+L+GFGINA+NN+R FLAG++DNVI QI++  K+LAFPGS  +V++L+ NQK+SHF +A
Sbjct  526  LHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQKESHFVSA 585
Query  413  QP 414
            +P
Sbjct  586  RP 587

Sequence Alignment: 7. Allergen Name: Ara h 1 Sequence ID: P43237

 Score = 348.4 bits 1501,  Expect = 5e-97
 Identities = 227/408 55%, Positives = 321/408 78%, Gaps = 16/408 3%
Query  3    SDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQ 62
            + + NPF F S RF T Y N+NG IR+LQRFD+RSK F+NLQN+R+++ +++P+T+ LP+
Sbjct  163  TSRNNPFYFPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLVLPK 222
Query  63   FTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDL 122
              DAD ILV+  G+A +TV N N+R SFNL+ G  +++P+G I+Y+ NR DN++LRV  +
Sbjct  223  HADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILNRHDNQNLRVAKI 282
Query  123  AIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEE-----QEQK 177
            ++PVN PGQ++ F+ + +++Q S+L GFS+N LEAAFN E+ EI +VLLEE     QE++
Sbjct  283  SMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFNAEFNEIRRVLLEENAGGEQEER 342
Query  178  SQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSE--SEPFNLRSRNPI 235
             Q RRS R       NE VIVKVS+E+++EL+K+AKS SKK    E  + P NLR   P 
Sbjct  343  GQRRRSTRSS----DNEGVIVKVSKEHVQELTKHAKSVSKKGSEEEDITNPINLRDGEPD 398
Query  236  YSNKFGKFFEITPEK-NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFE 294
             SN FG++FE+ P+K NPQLQDLD+ +  VEIKEG+L+LP++NS+A+VIV VN+G G++E
Sbjct  399  LSNNFGRLFEVKPDKKNPQLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLE 458
Query  295  LVGQRNENQQEQREEND---EEEGQEEE-TTKQVQRYRARLSPGDVLVIPAGHPVAINAS 350
            LV  R E QQ  R E +   EEE +EEE + ++V+RY ARL  GDV+++PA HPVAINAS
Sbjct  459  LVAVRKEQQQRGRREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINAS 518
Query  351  SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFA 410
            S+L+L+GFGINA+NN+R FLAG++DNVI QI++  K+LAFPGS  +V++L+ NQ++SHF 
Sbjct  519  SELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIKNQRESHFV 578
Query  411  NAQP 414
            +A+P
Sbjct  579  SARP 582

Sequence Alignment: 8. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 278.9 bits 1196,  Expect = 4e-76
 Identities = 229/399 57%, Positives = 339/399 84%, Gaps = 18/399 4%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
            R   +NPF F S RFQT+++N+ GH+R+LQRF+KRS+ ++NL++YR+LE+ SKP+T++LP
Sbjct  143  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 202
Query  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
            +  DAD+++V+L+G AILT++N++DR+S+NL+ GD +++PAGT  Y+ N D++E+LR++ 
Sbjct  203  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTYYVVNPDNDENLRMIT 262
Query  122  LAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHR 181
            LAIPVN+PG+++SF+LS TQ Q S+L GFSKNILEA+++T++EEI KVL+  +E + Q  
Sbjct  263  LAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGE 322
Query  182  RSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
              L+        E VIV++S++QI ELSK+AKSSS+K++SSE +PFNLRSR+PIYSNK+G
Sbjct  323  ERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 374
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNE 301
            K+FEITPEKNPQL+DLD+F++ V++ EG+L+LP++NS+AIV++ +NEG+ + ELVG +  
Sbjct  375  KLFEITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVGIK-- 432
Query  302  NQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGIN 361
             +Q+QR+       Q+EE   +V++YRA LS  D++VIPAG+PV +NA+SDLN+  FGIN
Sbjct  433  -EQQQRQ-------QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFAFGIN 484
Query  362  AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418
            A+NNQRNFLAG +DNVISQI   V+ELAFPGS+++++ L+ +Q +S+F +AQP Q E
Sbjct  485  AENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSESYFVDAQPQQKE 541

Sequence Alignment: 9. Allergen Name: Gly m 5.0101 Sequence ID: O22120

 Score = 274.8 bits 1178,  Expect = 7e-75
 Identities = 230/399 57%, Positives = 334/399 83%, Gaps = 18/399 4%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
            R   +NPF+F SNRF+T+++N+ G IR+LQRF++RS  ++NL++YR+LE+ SKP+T++LP
Sbjct  127  RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP 186
Query  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
               DAD+++V+L+G AIL+++N++DR+S+ L+ GD +++P+GT  Y+ N D+NE+LR++ 
Sbjct  187  NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLIT 246
Query  122  LAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHR 181
            LAIPVN+PG+++SF+LS T+ Q S+L GFS+NILEA+++T++EEI KVL+  +E + Q  
Sbjct  247  LAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGE 306
Query  182  RSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
            + L+        E VIV++S+EQI  LSK AKSSS+K++SSE +PFNLRSR+PIYSNK+G
Sbjct  307  QRLQ--------ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 358
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNE 301
            KFFEITPEKNPQL+DLDIF++ V++ EG+LLLP++NS+AIVI+ +NEG  + ELVG + E
Sbjct  359  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLK-E 417
Query  302  NQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGIN 361
             QQEQ         Q+EE   +V++YRA LS  D++VIPAG+PV +NA+S+LN+   GIN
Sbjct  418  QQQEQ---------QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGIN 468
Query  362  AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418
            A+NNQRNFLAG +DNVISQI   V+ELAFPGS++ V++LL NQ++S+F +AQP + E
Sbjct  469  AENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE 525

Sequence Alignment: 10. Allergen Name: Gly m conglycinin Sequence ID: CAA35691

 Score = 274.8 bits 1178,  Expect = 8e-75
 Identities = 230/399 57%, Positives = 334/399 83%, Gaps = 18/399 4%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
            R   +NPF+F SNRF+T+++N+ G IR+LQRF++RS  ++NL++YR+LE+ SKP+T++LP
Sbjct  189  RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP 248
Query  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
               DAD+++V+L+G AIL+++N++DR+S+ L+ GD +++P+GT  Y+ N D+NE+LR++ 
Sbjct  249  NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLIT 308
Query  122  LAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHR 181
            LAIPVN+PG+++SF+LS T+ Q S+L GFS+NILEA+++T++EEI KVL+  +E + Q  
Sbjct  309  LAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGE 368
Query  182  RSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
            + L+        E VIV++S+EQI  LSK AKSSS+K++SSE +PFNLRSR+PIYSNK+G
Sbjct  369  QRLQ--------ESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLG 420
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNE 301
            KFFEITPEKNPQL+DLDIF++ V++ EG+LLLP++NS+AIVI+ +NEG  + ELVG + E
Sbjct  421  KFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLK-E 479
Query  302  NQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGIN 361
             QQEQ         Q+EE   +V++YRA LS  D++VIPAG+PV +NA+S+LN+   GIN
Sbjct  480  QQQEQ---------QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGIN 530
Query  362  AKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418
            A+NNQRNFLAG +DNVISQI   V+ELAFPGS++ V++LL NQ++S+F +AQP + E
Sbjct  531  AENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE 587

Sequence Alignment: 11. Allergen Name: Vig r 2.0201 Sequence ID: B1NPN8

 Score = 273.0 bits 1170,  Expect = 2e-74
 Identities = 237/397 59%, Positives = 326/397 82%, Gaps = 18/397 4%
Query  5    QENPFIFKSNR-FQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF 63
            + NPF F S+R F+T++ N+ GH+R+LQRFD+RSK  +NL+NYR++E  SKP+T++LP+ 
Sbjct  43   KNNPFYFNSDRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPHH 102
Query  64   TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DADF+LVVL+G+A+LT++N + R+S  LE+G   K+PAGT  +L N DDNE+LR++ LA
Sbjct  103  ADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPDDNENLRIIKLA 162
Query  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
            +PVN P ++Q F+LS T+ Q S+L GFSKNILEA+F+++ +EI +VL+ E+ Q+ Q    
Sbjct  163  VPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSDIKEISRVLFGEEGQQQQ---- 218
Query  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKF 243
               + QE   E VIV++ REQI EL+K+AKSSSKKS+SSE +PFNLR++ PIYSNK+G++
Sbjct  219  ---QGQESQQEGVIVELKREQIRELTKHAKSSSKKSLSSEDQPFNLRNQKPIYSNKLGRW 275
Query  244  FEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQ 303
            FEITPEKNPQL+DLD+F+ SV++KEGSLLLP+YNS+AIVI+ +NEGK + ELVGQR   Q
Sbjct  276  FEITPEKNPQLRDLDMFIRSVDMKEGSLLLPHYNSKAIVILVINEGKANIELVGQRE--Q 333
Query  304  QEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAK 363
            Q+Q+EE      QEE  + +VQRYRA LS  DV++IPA +PVAINA+S+LN+  FGINA+
Sbjct  334  QKQQEE------QEE--SWEVQRYRAELSEDDVFIIPATYPVAINATSNLNFFAFGINAE 385
Query  364  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418
            NNQRNFLAGE+DNVIS+I   V ++ FP S  +V +L+  Q +S+F +AQP Q E
Sbjct  386  NNQRNFLAGEKDNVISEIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQE 440

Sequence Alignment: 12. Allergen Name: Vig r 2.0101 Sequence ID: Q198W3

 Score = 268.5 bits 1150,  Expect = 5e-73
 Identities = 228/390 58%, Positives = 326/390 83%, Gaps = 23/390 5%
Query  5    QENPFIFKSNR-FQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF 63
            Q NPF F S+R F+T+++N+ GH+R+++RFD+RSK  +NL+NYR++E+KSKP+T++LP+ 
Sbjct  41   QNNPFYFNSDRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPHH 100
Query  64   TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DADF+LVVL+G+AILT++N + R+S+ LE+G   K+PAGT  +L N +DN++LR++ LA
Sbjct  101  ADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPNDNDNLRIIKLA 160
Query  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
            IPVN P ++Q+F+LS T+ Q S+L GFSKNILEA+F+++++EI++VL+ E+ Q+ QH   
Sbjct  161  IPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSDFKEIDRVLFGEERQQ-QH--- 216
Query  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKF 243
              ++ QE   E VIV++ REQI EL K+AKSSS+K +SS+ EPFNLR+ NPIYSNKFG++
Sbjct  217  -GEESQE---EGVIVELKREQIRELIKHAKSSSRKELSSQDEPFNLRNSNPIYSNKFGRW 272
Query  244  FEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQ 303
            +EITPEKNPQL+DLD+F++SV++KEG LLLP+YNS+AIVI+ +NEG+   ELVG  ++ Q
Sbjct  273  YEITPEKNPQLKDLDVFISSVDMKEGGLLLPHYNSKAIVILVINEGEAKIELVGPSDQQQ 332
Query  304  QEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAK 363
            Q++  E              VQRYRA LS  DV+VIPA +PVAINA+S+LN+  FGINA+
Sbjct  333  QDESLE--------------VQRYRAELSEDDVFVIPAAYPVAINATSNLNFFAFGINAE 378
Query  364  NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQ 416
            NNQRNFLAGE+DNV+S+I   V +++FP S  +V++L+  Q +SHF +AQP Q
Sbjct  379  NNQRNFLAGEKDNVMSEIPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQ 431

Sequence Alignment: 13. Allergen Name: Gly m conglycinin Sequence ID: AAB01374

 Score = 200.0 bits 850,  Expect = 3e-52
 Identities = 226/398 56%, Positives = 338/398 84%, Gaps = 38/398 9%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
            R   +NPF F S RFQT+++N+ GH+R+LQRF+KRS+ ++NL++YR+LE+ SKP+T++LP
Sbjct  205  RHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQLQNLRDYRILEFNSKPNTLLLP 264
Query  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGT---------------IA 106
            +  DAD+++V+L+G AILT++N++DR+S+NL+ GD +++PAGT               IA
Sbjct  265  HHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGTTFYVVNPDNDENLRMIA 324
Query  107  ----YLANRDDNEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTE 162
                Y+ N D++E+LR++ LAIPVN+PG+++SF+LS TQ Q S+L GFSKNILEA+++T+
Sbjct  325  GTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTK 384
Query  163  YEEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSS 222
            +EEI KVL+  +E + Q    L+        E VIV++S++QI ELSK+AKSSS+K++SS
Sbjct  385  FEEINKVLFGREEGQQQGEERLQ--------ESVIVEISKKQIRELSKHAKSSSRKTISS 436
Query  223  ESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIV 282
            E +PFNL SR+PIYSNK+GK+FEIT ++NPQL+DLD+F++ V++ EG+L+LP++NS+AIV
Sbjct  437  EDKPFNLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIV 495
Query  283  IVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAG 342
            ++ +NEG+ + ELVG +   +Q+QR+       Q+EE   +V++YRA LS  D++VIPAG
Sbjct  496  VLVINEGEANIELVGIK---EQQQRQ-------QQEEQPLEVRKYRAELSEQDIFVIPAG 545
Query  343  HPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLT 402
            +PV +NA+SDLN+  FGINA+NNQRNFLAG +DNVISQI   V+ELAFP S+++++ L+ 
Sbjct  546  YPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIK 605
Query  403  NQKQSHFANAQPLQIE 418
            +Q +S+F +AQP Q E
Sbjct  606  SQSESYFVDAQPQQKE 621

Sequence Alignment: 14. Allergen Name: Gly m conglycinin Sequence ID: AAB23463

 Score = 164.5 bits 694,  Expect = 9e-42
 Identities = 245/393 62%, Positives = 333/393 84%, Gaps = 26/393 6%
Query  2    RSDQENPFIFKS-NRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFL 60
            R D+ NPF F+S N FQT++EN+N  IRLLQRF+KRS  +ENL++YR+++++SKP+TI+L
Sbjct  27   REDENNPFYFRSSNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILL 86
Query  61   PQFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL 120
            P+  DADF+L VLSG+AILT++N++DR+S+NL  GD  ++PAGT  YL N  D+++L+++
Sbjct  87   PHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKII 146
Query  121  DLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLL-EEQEQKSQ 179
             LAIPVN+PG+   F+LS TQ Q S+L GFS NILE +F++E+EEI +VL+ EE+EQ+ Q
Sbjct  147  KLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQ 206
Query  180  HRRSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNK 239
                          E VIV++S+EQI +LS+ AKSSS+K++SSE EPFNLRSRNPIYSN 
Sbjct  207  --------------EGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNN 252
Query  240  FGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQR 299
            FGKFFEITPEKNPQL+DLDIF++SV+I EG+LLLP++NS+AIVI+ +NEG  + ELVG +
Sbjct  253  FGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIK 312
Query  300  NENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFG 359
             E QQ+Q+        QEEE   +VQRYRA LS  DV+VIPA +P  +NA+S+LN++ FG
Sbjct  313  -EQQQKQK--------QEEEPL-EVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFG 362
Query  360  INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQIE 418
            INA+NNQRNFLAGE+DNV+ QI+R V+ELAFPGS+++V+RLL  Q++S+F +AQP Q E
Sbjct  363  INAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKE 421

Sequence Alignment: 15. Allergen Name: Gos h 1 Sequence ID: P09801

 Score = 138.9 bits 582,  Expect = 6e-34
 Identities = 160/392 40%, Positives = 249/392 63%, Gaps = 26/392 6%
Query  7    NPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDA 66
            NPF F    FQ+ +  E+G+ R+LQRF  R  I+  +  +RL   ++ P+T  LP+  DA
Sbjct  180  NPFHFHRRSFQSRFREEHGNFRVLQRFASRHPILRGINEFRLSILEANPNTFVLPHHCDA 239
Query  67   DFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPV 126
            + I +V +G+  LT L   ++ S+N+  G  +++PAG+  YLAN+D+ E L +  L  PV
Sbjct  240  EKIYLVTNGRGTLTFLTHENKESYNVVPGVVVRVPAGSTVYLANQDNKEKLIIAVLHRPV 299
Query  127  NRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRD 186
            N P Q++ F+ +G+Q   S+L  FS+ ILE AFNT  E++++++   Q     HRR    
Sbjct  300  NNPRQFEEFFPAGSQRPQSYLRAFSREILEPAFNTRSEQLDELFGGRQ----SHRRQ--- 352
Query  187  KRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEI 246
                   + +  K S+EQI  LS+ A S  +KS   E   FNL  R P YSN+ G+F+E 
Sbjct  353  -----QGQGMFRKASQEQIRALSQEATSPREKS--GERFAFNLLYRTPRYSNQNGRFYEA 405
Query  247  TPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQ---RNENQ 303
             P +  QL D+++ V+++++ +GS+++P+YNS+A  +V VNEG G  E+V     R  + 
Sbjct  406  CPREFRQLSDINVTVSALQLNQGSIFVPHYNSKATFVVLVNEGNGYVEMVSPHLPRQSSF 465
Query  304  QEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFG-- 359
            +E+ E+  E+E +EE  + Q ++ R++LS GD++V+PA  PV   AS + NL   GFG  
Sbjct  466  EEEEEQQQEQEQEEERRSGQYRKIRSQLSRGDIFVVPANFPVTFVASQNQNLRMTGFGLY 525
Query  360  ---INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQ-SHFANAQ 413
               IN  +NQR F+AG+ ++V  Q     KELAF  SSR VD ++ N  Q S+F + Q
Sbjct  526  NQNINPDHNQRIFVAGKINHV-RQWDSQAKELAFGVSSRLVDEIFNNNPQESYFVSRQ 582

Sequence Alignment: 16. Allergen Name: Gos h 2 Sequence ID: P09799

 Score = 134.6 bits 563,  Expect = 1e-32
 Identities = 161/397 40%, Positives = 249/397 62%, Gaps = 23/397 5%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
            +  + NP+ F    FQ  +  E+G+ R+LQRF  +  ++  +  +R+   ++ P+T  LP
Sbjct  176  QQQRNNPYYFHRRSFQERFREEHGNFRVLQRFADKHHLLRGINEFRIAILEANPNTFVLP 235
Query  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
            +  DA+ I VV +G+  +T +   ++ S+N+  G  +++PAG+  YLAN+D+ E L +  
Sbjct  236  HHCDAEKIYVVTNGRGTVTFVTHENKESYNVVPGVVVRIPAGSTVYLANQDNREKLTIAV 295
Query  122  LAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHR 181
            L  PVN PGQ+Q F+ +G +N  S+L  FS+ ILEA FNT  E+++    E    +  HR
Sbjct  296  LHRPVNNPGQFQKFFPAGQENPQSYLRIFSREILEAVFNTRSEQLD----ELPGGRQSHR 351
Query  182  RSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFG 241
                  RQ+   + +  K S+EQI  LS+ A S   K   SE   FNL S+ P YSN+ G
Sbjct  352  ------RQQ--GQGMFRKASQEQIRALSQGATSPRGKG--SEGYAFNLLSQTPRYSNQNG 401
Query  242  KFFEITPEK-NPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVG--- 297
            +F+E  P     QL+++D  V + EI +GS+++P+YNS+A  +V V EG G  E+V    
Sbjct  402  RFYEACPRNFQQQLREVDSSVVAFEINKGSIFVPHYNSKATFVVLVTEGNGHVEMVCPHL 461
Query  298  QRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASS--DLNL 355
             R  +    REE ++EE + E  + Q +R RA+LS G+++V+PAGHPV   AS   DL L
Sbjct  462  SRQSSDWSSREEEEQEEQEVERRSGQYKRVRAQLSTGNLFVVPAGHPVTFVASQNEDLGL 521
Query  356  IGFGI-NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQ-SHFANAQ 413
            +GFG+ N ++N+R F+AG+ +NV  Q  R  KELAF   SR VD ++ N  Q S+F + +
Sbjct  522  LGFGLYNGQDNKRIFVAGKTNNV-RQWDRQAKELAFGVESRLVDEVFNNNPQESYFVSGR 580

Sequence Alignment: 17. Allergen Name: Mac i 1.0101 Sequence ID: Q9SPL3

 Score = 115.7 bits 480,  Expect = 6e-27
 Identities = 161/382 42%, Positives = 244/382 63%, Gaps = 28/382 7%
Query  6    ENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTD 65
            +NP+ F    + T +  E GHI +L+ F  RSK++  L+NYRL+  ++ P+   LP   D
Sbjct  208  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 267
Query  66   ADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIP 125
            AD IL+V+ G+  L +++ ++R S+NLE GD I++PAGT  YL NRD+NE L +  +   
Sbjct  268  ADAILLVIGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 327
Query  126  VNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLR 185
            ++ PGQ + F+ +G QN   +LS FSK ILEAA+NT+ E +  VL        Q+R    
Sbjct  328  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVL-------GQQR---- 376
Query  186  DKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE----PFNLRSRNPIYSNKFG 241
                    E VI++ S+EQI EL+++   S +  +    E    P+NL ++ P+YSNK+G
Sbjct  377  --------EGVIIRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYG 428
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNE 301
            + +E+ PE   QLQD+D+ V    I +GS++ P +N+R+  +V V  G+ D E+      
Sbjct  429  QAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS 488
Query  302  NQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLI--GFG 359
             ++  R      E +EE   +QV   RARLS  + +V+ AGHPV   +S + NL+   FG
Sbjct  489  GRHGGRGGGKRHEEEEEVHYEQV---RARLSKREAIVVLAGHPVVFVSSGNENLLLFAFG 545
Query  360  INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            INA+NN+ NFLAG E NV+ QI+    ELAF  S +EV+ L+ +Q +S F
Sbjct  546  INAQNNHENFLAGRERNVLQQIEPQAMELAFAASRKEVEELFNSQDESIF 595

Sequence Alignment: 18. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 113.5 bits 470,  Expect = 2e-26
 Identities = 152/371 40%, Positives = 239/371 64%, Gaps = 41/371 11%
Query  2    RSDQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLP 61
            +  +ENP++F+   F++  + E G +++L+ F KRS+++  ++N+RL   ++ PHT   P
Sbjct  55   KEQEENPYVFQDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP 114
Query  62   QFTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLD 121
               DA+++L V  G+A +T++    R SFN+E GD I++PAGT  Y+ NRD+NE L ++ 
Sbjct  115  AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVK 174
Query  122  LAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHR 181
            +  PV+ PG++++F  +G ++  SF   FS  +LEAA+    E++EKV+  EQ + S   
Sbjct  175  ILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVF-GEQSKGS--- 230
Query  182  RSLRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKK-SVSSESE-PFNLRSRNPIYSNK 239
                           IVK SRE+I  LS++ +   +      ES  P NL  ++P  SN+
Sbjct  231  ---------------IVKASREKIRALSQHEEGPPRIWPFGGESSGPINLLHKHPSQSNQ 275
Query  240  FGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQR 299
            FG+++E  P+ + QLQDLD+ V+   I +GS+  P YNSRA  I  V EG+G FE+    
Sbjct  276  FGRLYEAHPDDHKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPH 335
Query  300  NENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IG 357
              +                 ++   Q+  ARL  G V+V PAGHPVA+ AS + NL  + 
Sbjct  336  LSS-----------------SSGSYQKISARLRRGVVFVAPAGHPVAVIASQNNNLQVLC 378
Query  358  FGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            F +NA  N R  LAG+  N++++ +R  KELAF   SREV+R++ NQ Q+ F
Sbjct  379  FEVNAHGNSRFPLAGK-GNIVNEFERDAKELAFNLPSREVERIFKNQDQAFF 429

Sequence Alignment: 19. Allergen Name: Mac i 1.0201 Sequence ID: Q9SPL4

 Score = 113.8 bits 472,  Expect = 2e-26
 Identities = 158/382 41%, Positives = 241/382 63%, Gaps = 28/382 7%
Query  6    ENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTD 65
            +NP+ F    + T +  E GHI +L+ F  RSK++  L+NYRL+  ++ P+   LP   D
Sbjct  249  DNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLD 308
Query  66   ADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIP 125
            AD IL+V  G+  L +++ ++R S+NLE GD I++PAGT  YL NRD+NE L +  +   
Sbjct  309  ADAILLVTGGRGALKMIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQT 368
Query  126  VNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLR 185
            ++ PGQ + F+ +G QN   +LS FSK ILEAA+NT+ E +  VL        Q+R    
Sbjct  369  ISTPGQYKEFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVL-------GQQR---- 417
Query  186  DKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE----PFNLRSRNPIYSNKFG 241
                    E VI+  S+EQI EL+++   S +  +    E    P+NL ++ P+YSNK+G
Sbjct  418  --------EGVIISASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYG 469
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNE 301
            + +E+ PE   QLQD+D+ V    I +GS++ P +N+R+  +V V  G+ D E+      
Sbjct  470  QAYEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLS 529
Query  302  NQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLI--GFG 359
             ++  R      E +E+   +QV   +ARLS  + +V+P GHPV   +S + NL+   FG
Sbjct  530  GRHGGRRGGKRHEEEEDVHYEQV---KARLSKREAIVVPVGHPVVFVSSGNENLLLFAFG 586
Query  360  INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            INA+NN+ NFLAG E NV+ QI+    ELAF    +EV+ L+ +Q +S F
Sbjct  587  INAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNSQDESIF 636

Sequence Alignment: 20. Allergen Name: Gly m conglycinin Sequence ID: AAA33947

 Score = 109.4 bits 451,  Expect = 2e-25
 Identities = 127/200 63%, Positives = 169/200 84%, Gaps = 10/200 5%
Query  209  SKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKE 268
            SK AKSSS+K++SSE +PFNL SR+PIYS K+GKFFEITPEKNPQL+DLDIF++ V++ E
Sbjct  1    SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE 60
Query  269  GSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYR 328
            G+LLLP++NS+AIVI+ +NEG  + ELVG + E QQEQ         Q+EE   +V++YR
Sbjct  61   GALLLPHFNSKAIVILVINEGDANIELVGLK-EQQQEQ---------QQEEQPLEVRKYR 110
Query  329  ARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKEL 388
            A LS  D++VIPAG+PV +NA+S+LN+   GINA+NNQRNFLAG +DNVISQI   V+EL
Sbjct  111  AELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQEL 170
Query  389  AFPGSSREVDRLLTNQKQSHFANAQPLQIE 418
            AFPGS++ V++LL NQ++S+F +AQP + E
Sbjct  171  AFPGSAQAVEKLLKNQRESYFVDAQPNEKE 200

Sequence Alignment: 21. Allergen Name: Car i 2.0101 Sequence ID: B3STU4

 Score = 110.4 bits 457,  Expect = 3e-25
 Identities = 164/387 42%, Positives = 269/387 69%, Gaps = 22/387 5%
Query  5    QENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFT 64
            + NP+ F S  +++ +E+  G ++ L+RF +R++++  ++NYR++  ++ P+T  LP   
Sbjct  375  RHNPYYFHSQGLRSRHESGEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHK 434
Query  65   DADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI 124
            DA+ ++VV  G+A LT ++   R SFNLE GD I++PAG   Y+ N+D NE L ++ L  
Sbjct  435  DAESVIVVTRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKLLQ 494
Query  125  PVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSL 184
            PVN PGQ++ +  +G Q+  S+L  FS +IL AA+NT  + +E+ ++++QEQ+       
Sbjct  495  PVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLER-FFDQQEQR------- 546
Query  185  RDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE--PFNLRSRNPIYSNKFGK 242
                     E VI++ S+E++  LS++A S+ ++     S   P +L+S+   YSN+FG+
Sbjct  547  ---------EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSQRSSYSNQFGQ 597
Query  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNEN 302
            FFE  PE++ QLQ++D++VN  EIK G++++P+YNS+A V+V V EG G FE+    + +
Sbjct  598  FFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRFEMACPHDVS 657
Query  303  QQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFGI 360
             Q    +   E+ +EE +T Q Q+  ARL+ GD++VIPAGHP+AI AS + NL  +GFGI
Sbjct  658  SQSYEYKGRREQEEEESSTGQFQKVTARLARGDIFVIPAGHPIAITASQNENLRLVGFGI 717
Query  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            N KNNQRNFLAG+ +N+I+Q++R  KEL+F     E++ ++  Q +S+F
Sbjct  718  NGKNNQRNFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFERQVESYF 765

Sequence Alignment: 22. Allergen Name: Jug n 2 Sequence ID: AAM54366

 Score = 109.1 bits 451,  Expect = 5e-25
 Identities = 163/385 42%, Positives = 271/385 70%, Gaps = 25/385 6%
Query  5    QENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFT 64
            + NP+ F S   ++ +E+E G ++ L+RF +R++++  ++NYR++   + P+T  LP+  
Sbjct  66   RHNPYYFHSQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFMLPHHK 125
Query  65   DADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI 124
            DA+ ++VV  G+A LT+++   R SFNLE GD I++PAG   Y+ N+D NE L ++ L  
Sbjct  126  DAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQDSNERLEMVKLLQ 185
Query  125  PVNRPGQLQSFLLSGTQN-QPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
            PVN PGQ++ +  +G ++   S+L  FS +IL AA+NT  + +E+ ++++QEQ+      
Sbjct  186  PVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFDQQEQR------ 238
Query  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE--PFNLRSRNPIYSNKFG 241
                      E VI++ S+E++  LS++A S+ ++     S   P +L+S  P YSN+FG
Sbjct  239  ----------EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSERPSYSNQFG 288
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNE 301
            +FFE  PE++ QLQ++D++VN  EIK G++++P+YNS+A V+V V EG G +E+      
Sbjct  289  QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVS 348
Query  302  NQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFG 359
            +Q    E+    E +EEE+T + Q+  ARL+ GD++VIPAGHP+AI AS + NL  +GFG
Sbjct  349  SQSF--EDQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFG 406
Query  360  INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            IN +NNQRNFLAG+ +++I+Q++R  KEL+F     E++ ++ +Q +S+F
Sbjct  407  INGENNQRNFLAGQ-NSIINQLEREAKELSFNMPREEIEEIFESQMESYF 455

Sequence Alignment: 23. Allergen Name: Jug r 6.0101 Sequence ID: A0A2I4E5L6

 Score = 108.6 bits 449,  Expect = 7e-25
 Identities = 151/385 39%, Positives = 248/385 64%, Gaps = 27/385 7%
Query  4    DQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF 63
            ++ENP++F+   F+T    + G I++L++F KRSK++  ++N+R+   ++ P+T   P  
Sbjct  96   EEENPYVFEDEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQTFISPAH 155
Query  64   TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DA++++ V  G+A +T +    R +FN+E+GD +++PAGT  YL NRD+NE L ++ + 
Sbjct  156  FDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRDENEKLYIVKIL 215
Query  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
             PV+ PG++++F  SG ++  SF   FS  +LEAA+ T  +++EK L+ +Q Q       
Sbjct  216  RPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTRRDQLEK-LFGKQTQ------- 267
Query  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSK--KSVSSESEPFNLRSRNPIYSNKFG 241
                        VI+K S+EQI  +SK+ +++ +        + PFNL  + P  SN+FG
Sbjct  268  -----------GVIIKASKEQIRSMSKHEETTPRIWPFGGDSTHPFNLFHKRPSQSNQFG 316
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQR-- 299
            ++FE  P++  QLQDLD+ V+   I +GS+  P YNSRA  I  V EG+G FE+      
Sbjct  317  RLFETDPKECKQLQDLDLMVSFANITKGSMAGPYYNSRATKISVVIEGEGYFEMACPHLS 376
Query  300  NENQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IG 357
            +   + QRE +     +   +    Q+ R RL PG V+V PAGHPVA+ AS + NL  + 
Sbjct  377  SSGSRGQREGSGSSR-RRSRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLC 435
Query  358  FGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            F +NA+ N R  LAG+ +N++++ ++  KELAF   +REV++++ NQ Q  F
Sbjct  436  FDVNAQGNIRFPLAGK-NNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFF 486

Sequence Alignment: 24. Allergen Name: Jug r 2 Sequence ID: AAF18269

 Score = 107.9 bits 446,  Expect = 1e-24
 Identities = 162/385 42%, Positives = 269/385 69%, Gaps = 25/385 6%
Query  5    QENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFT 64
            + NP+ F S   ++ +E+E G ++ L+RF +R++++  ++NYR++   + P+T  LP+  
Sbjct  178  RHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVILDANPNTSMLPHHK 237
Query  65   DADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAI 124
            DA+ + VV  G+A LT+++   R SFNLE GD I++PAG   Y+ N+D NE L ++ L  
Sbjct  238  DAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATVYVINQDSNERLEMVKLLQ 297
Query  125  PVNRPGQLQSFLLSGTQN-QPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
            PVN PGQ++ +  +G ++   S+L  FS +IL AA+NT  + +E+ ++++QEQ+      
Sbjct  298  PVNNPGQFREYYAAGAKSPDQSYLRVFSNDILVAALNTPRDRLER-FFDQQEQR------ 350
Query  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE--PFNLRSRNPIYSNKFG 241
                      E VI++ S+E++  LS++A S+ ++     S   P +L+S +P YSN+FG
Sbjct  351  ----------EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFG 400
Query  242  KFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNE 301
            +FFE  PE++ QLQ++D++VN  EIK G++++P+YNS+A V+V V EG G +E+      
Sbjct  401  QFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVS 460
Query  302  NQQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFG 359
            +Q    E     E +EEE+T + Q+  ARL+ GD++VIPAGHP+AI AS + NL  +GF 
Sbjct  461  SQ--SYEGQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFD 518
Query  360  INAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            IN +NNQR+FLAG+ +N+I+Q++R  KEL+F     E++ ++ +Q +S+F
Sbjct  519  INGENNQRDFLAGQ-NNIINQLEREAKELSFNMPREEIEEIFESQMESYF 567

Sequence Alignment: 25. Allergen Name: Ses i 3 Sequence ID: AAK15089

 Score = 105.0 bits 433,  Expect = 1e-23
 Identities = 135/375 36%, Positives = 235/375 62%, Gaps = 29/375 7%
Query  8    PFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTDAD 67
            P++F+   F T +  ++G +R+LQ+F  RS+++  ++NYR+   +++P+T  +P   DA+
Sbjct  195  PYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAE 254
Query  68   FILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVN 127
             ++ V  G+  ++++  + R S+N+++GD +K+ AGT AYL NRD+NE L +  L  PV+
Sbjct  255  SVVFVAKGRGTISLVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVS 314
Query  128  RPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDK 187
             PG+++ F+ +G +N  SF+  FS  ILEAAFNT  + +++++        Q+R+     
Sbjct  315  TPGEFELFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIF-------GQQRQG---- 363
Query  188  RQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEIT 247
                    VIVK S EQ+  +S++ +              N+  + P +SN++G++ E+ 
Sbjct  364  --------VIVKASEEQVRAMSRHEEGGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVD 415
Query  248  PEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQR 307
              +  QL+DLD+ V+   I +G++  P+YNS+A  I  V +G+G FE+        +   
Sbjct  416  ASQYRQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMSRSRGSY 475
Query  308  EENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFGINAKNN 365
            +   E  G+        QR  +RL+ G V++IPAGHP    ASS+ NL  + F +NA NN
Sbjct  476  Q--GETRGRP-----SYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQVLCFEVNANNN 528
Query  366  QRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            ++  LAG   NV++Q++R  KELAF   +REV+ +  +Q++  F
Sbjct  529  EKFPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQEEFF 571

Sequence Alignment: 26. Allergen Name: Pis v 3.0101 Sequence ID: EF116865

 Score = 102.7 bits 423,  Expect = 4e-23
 Identities = 141/377 37%, Positives = 223/377 59%, Gaps = 32/377 8%
Query  4    DQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF 63
            + ENP++F+   F T  + E G + +L +F KRSK++  L+ YRL    + P+   +P  
Sbjct  124  EDENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNH 183
Query  64   TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DAD I+ V  G+  +T +  N R S N+++GD I++ AGT  Y+ N D+NE L ++ L 
Sbjct  184  MDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLL 243
Query  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
             PVN PG+ + F   G +N  SF   FS+ +LEAA+ T  +++EK L+E+Q+        
Sbjct  244  QPVNLPGHYEVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEK-LFEKQD-------- 294
Query  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE-PFNLRSRNPIYSNKFGK 242
                      E  IVK S+EQI  +S+  +  S    + +S   FNL  ++P  SN +G+
Sbjct  295  ----------EGAIVKASKEQIRAMSRRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQ 344
Query  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNEN 302
            +FE   +  P LQ+LDI V+ V I +G +  P YNSRA  I  V  G+G +E+      +
Sbjct  345  LFESEFKDYPPLQELDIMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSS 404
Query  303  QQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFGI 360
             +          GQE+ +    ++  + +    V+V+PAGHP    AS + NL  + F +
Sbjct  405  SKNS--------GQEK-SGPSYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEV 455
Query  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            NA+ N R  LAG++ N+I  +++  KELAF     EVD+++  Q +  F
Sbjct  456  NAEGNIRYTLAGKK-NIIEVMEKEAKELAFKTKGEEVDKVFGKQDEEFF 503

Sequence Alignment: 27. Allergen Name: Ana o 1.0102 Sequence ID: AAM73729

 Score = 99.1 bits 407,  Expect = 6e-22
 Identities = 134/372 36%, Positives = 216/372 58%, Gaps = 37/372 9%
Query  4    DQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF 63
            + ENP++F+   F T  + E G + LL +F ++SK++  L+ YRL    + P+   +P  
Sbjct  146  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 205
Query  64   TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DAD I+ V  G+  +T +  N R S N+ +GD + + +GT  Y+AN D+NE L ++ + 
Sbjct  206  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 265
Query  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
             PVN PG+++ F   G +N  SF   FS  ILEAA+ T  + +EK L+E+Q+Q +     
Sbjct  266  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQDQGT----- 319
Query  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE-PFNLRSRNPIYSNKFGK 242
                         I+K S+EQ+  +S+  +       + ES   F L  ++P  SNK+G+
Sbjct  320  -------------IMKASKEQVRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQ 366
Query  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNEN 302
            +FE      P L+ LD+ V+   I +G + +P YNSRA  I  V  G+G  E+      +
Sbjct  367  LFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSS 426
Query  303  QQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFGI 360
             +                    ++ RAR+    V+++PAGHP A  AS + NL  + F +
Sbjct  427  SKSSHP--------------SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEV 472
Query  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            NA+ N R  LAG++ N+I  +++  KELAF     EVD+++  Q +  F
Sbjct  473  NAEGNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFF 520

Sequence Alignment: 28. Allergen Name: Ana o 1.0101 Sequence ID: AAM73730

 Score = 99.1 bits 407,  Expect = 6e-22
 Identities = 135/372 36%, Positives = 216/372 58%, Gaps = 37/372 9%
Query  4    DQENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF 63
            + ENP++F+   F T  + E G + LL +F ++SK++  L+ YRL    + P+   +P  
Sbjct  148  EDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRLAVLVANPQAFVVPSH 207
Query  64   TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA 123
             DAD I+ V  G+  +T +  N R S N+ +GD + + +GT  Y+AN D+NE L ++ + 
Sbjct  208  MDADSIFFVSWGRGTITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFL 267
Query  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
             PVN PG+++ F   G +N  SF   FS  ILEAA+ T  + +EK L+E+Q+Q +     
Sbjct  268  RPVNLPGHFEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEK-LFEKQDQGT----- 321
Query  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSESE-PFNLRSRNPIYSNKFGK 242
                         I+K S+EQI  +S+  +       + ES   F L  ++P  SNK+G+
Sbjct  322  -------------IMKASKEQIRAMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQ 368
Query  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNEN 302
            +FE      P L+ LD+ V+   I +G + +P YNSRA  I  V  G+G  E+      +
Sbjct  369  LFEAERIDYPPLEKLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIACPHLSS 428
Query  303  QQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNL--IGFGI 360
             +                    ++ RAR+    V+++PAGHP A  AS + NL  + F +
Sbjct  429  SKSSHP--------------SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEV 474
Query  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHF 409
            NA+ N R  LAG++ N+I  +++  KELAF     EVD+++  Q +  F
Sbjct  475  NAEGNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFF 522

Sequence Alignment: 29. Allergen Name: Pin k 2.0101 Sequence ID: V9VGU0

 Score = 92.9 bits 380,  Expect = 3e-20
 Identities = 134/375 35%, Positives = 222/375 59%, Gaps = 32/375 8%
Query  5    QENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFT 64
            +ENP++F S+RF+    +E G IR L  F + S+++E +  YR+   + KP+T+ LP++ 
Sbjct  63   EENPYVFHSDRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHYI 122
Query  65   DADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDLA- 123
            DA +IL V  G+  +  +  N+     LE GD   +P+G   YL N DD+  LR+  L  
Sbjct  123  DAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDDHNSLRIASLLR 182
Query  124  IPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRS 183
                  G+ + F ++G +N  +  S FS ++LEAAFNT+ +++E ++         HRR 
Sbjct  183  TESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDVQKLEHIF-------GAHRRG 235
Query  184  LRDKRQEITNEDVIVKVSREQIEELSKNAKSSSKKSVSSES-EPFNLRSRNPIYSNKFGK 242
                        VI   + EQI E+ +    S++ + +SE  +PFNLR++ P + N  G+
Sbjct  236  ------------VIFYANEEQIREMMRRGGFSAESTSASEQPKPFNLRNQKPDFENDNGR 283
Query  243  FFEITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNEN 302
            F    P+ NP L  +D+ V    +  G++  P++N++A  I  V EG+G  E+       
Sbjct  284  FTRAGPKDNPFLDSVDVTVGFGVLNPGTMTAPSHNTKATSIAIVMEGEGRIEMACPHL-- 341
Query  303  QQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSD--LNLIGFGI 360
             QE+   +  E G+++      +R RARL  G V V+PAGHP+   AS++  L ++ F I
Sbjct  342  GQEHGWSSPRERGHQD---INYERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDI 398
Query  361  NAKNNQRNFLAGEEDNVISQIQRPVKELAF--PGSSREVDRLLTNQK 405
            N   N+R FLAG+ +NV+  +++ V+ L+F  P    E++ +L  QK
Sbjct  399  NTSGNEREFLAGK-NNVLQTLEKEVRHLSFNIP-RGEEIEEVLQAQK 443

Sequence Alignment: 30. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 75.8 bits 305,  Expect = 5e-15
 Identities = 106/376 28%, Positives = 191/376 50%, Gaps = 59/376 15%
Query  4    DQENP-FIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQ 62
            D+++P  +F  +    +++ + G +R+L+    R  IF   ++  +     +P ++F+PQ
Sbjct  29   DKKSPKSLFLMSNSTRVFKTDAGEMRVLKSHGGR--IF--YRHMHIGFISMEPKSLFVPQ 84
Query  63   FTDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVLDL 122
            + D+++I+ +  G+A L  +  ++     L+ GD   +P+G+  YL N  + + L V+  
Sbjct  85   YLDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICS 144
Query  123  AIPVNRPG--QLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVLLEEQEQK--- 177
              P    G   +QSF + G  N  S LSGF   ILE AFN     +E+++ +E +     
Sbjct  145  IDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMF 204
Query  178  --SQHRRSLRDKRQEITNEDVIVKVSR-----EQIEELSKNAKSSSK------------- 217
                H  SL  K  ++  +D   ++ +     E+ EE  + ++S  K             
Sbjct  205  VDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKVNEKI 264
Query  218  --KSVSSESEPFNLRS-RNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLP 274
              K  +     +NL   +   + N +G    +   + P L + DI V  V++  GS+L P
Sbjct  265  ENKDTAGSPASYNLYDDKKADFKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSAGSMLAP 324
Query  275  NYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPG 334
            + N  +     V  G G++  +G  N              G     TK        +  G
Sbjct  325  HVNPISDEYTIVLSGYGELH-IGYPN--------------GSRAMKTK--------IKQG 361
Query  335  DVLVIPAGHPVAINASSD--LNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPG 392
            DV+V+P   P    AS D  L + GF  +A+ N+  FLAG   +++  +  P    AF  
Sbjct  362  DVFVVPRYFPFCQVASRDGPLEFFGFSTSARKNKPQFLAGAA-SLLRTLMGPELSAAFGV 420
Query  393  SSREVDRLLTNQKQS 407
            S   + R +  Q ++
Sbjct  421  SEDTLRRAVDAQHEA 435

Sequence Alignment: 31. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 65.1 bits 258,  Expect = 8e-12
 Identities = 101/381 26%, Positives = 181/381 47%, Gaps = 61/381 16%
Query  6    ENPFIFKSNRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQFTD 65
            E+  +F   R + + + + G +RL+  +  R     N     +     +P+T+++PQ+ D
Sbjct  51   EDRGLFILRRSKEVLKTDAGEVRLMMGYRYRG----NHSPMHIGFITMEPNTLYIPQYID 106
Query  66   ADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDDNEDLRVL---DL 122
            A +IL V  G+A +  +  N      L+ G    +PAG+  Y+ N D +E L ++   D 
Sbjct  107  ASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDT 166
Query  123  AIPVNRPGQL-QSFLLSGTQNQPSFLSGFSKNILEAAFNTEYEEIEKVL----------- 170
               +   G   QSF + G     S LSGF  + L AAFN   +++E +L           
Sbjct  167  LESMEYYGAYPQSFYVGGGVLPRSVLSGFDASTLSAAFNVSSDQLEMILNSQRGGPIIRL 226
Query  171  --------------LEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEEL--SKNAKS 214
                          ++ +E+  Q +    D   E   E+  V   R  ++ L    + + 
Sbjct  227  NGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRV 286
Query  215  SSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNSVEIKEGSLLLP 274
              K  ++     +NL    P Y N +G    I       L+  ++ V  V +K G++L P
Sbjct  287  QRKHKLAHSPGSYNLYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSP 346
Query  275  NYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYRARLSPG 334
            + N  A     +  G G  ++V                                A++S G
Sbjct  347  HVNPTATEYGIILRGSGTIQVVFPNGTAAMN-----------------------AKVSEG 383
Query  335  DVLVIPAGHPVAINAS--SDLNLIGFGINAKNNQRNFLAGEEDNVISQIQRPVKELAFPG 392
            DV+ IP   P    AS  + L + GF  +A+ N+  FL G+  +++  ++ P    AF  
Sbjct  384  DVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVGK-SSLLHSMRGPELAAAFGV 442
Query  393  SSREVDRLLTNQKQSHFANAQP 414
            S  +++R++  Q+++      P
Sbjct  443  SEEQLERIVKAQREAVILPTSP 464

Sequence Alignment: 32. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 40.8 bits 151,  Expect = 0.0001
 Identities = 35/118 29%, Positives = 64/118 54%, Gaps = 9/118 7%
Query  245  EITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELV--GQRNEN 302
            E   + NPQLQ  ++ V    I++  LL+P Y + A +   V +G+G    V  G     
Sbjct  6    EFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVV-QGRGIHGAVFPGCPETY 64
Query  303  QQEQREENDEEEGQEEETTKQVQRYRARLSPGDVLVIPAG--HPVAINASSDLNLIGF-G 359
            Q +Q++++ + +G   +   Q Q+ R ++  GD++ +P G  H +  N  S L L+ +  
Sbjct  65   QDQQQQQSYQSQGSRSQD--QHQKVR-QIREGDIIALPTGAAHWIYNNGGSQLVLVALVD 121
Query  360  INAKNNQ 366
            +   +NQ
Sbjct  122  VGNSDNQ 128

Sequence Alignment: 33. Allergen Name: Ses i 6.0101 Sequence ID: Q9XHP0

 Score = 36.9 bits 134,  Expect = 0.003
 Identities = 54/211 25%, Positives = 100/211 47%, Gaps = 30/211 14%
Query  92   LERGDTIKLPAGTIAYLANRDDNEDLRVLDLAIPVNRPGQL----QSFLL------SGTQ 141
            L +GD + +P+G   +  N D +EDL  + +    +   QL    ++F L      SG Q
Sbjct  147  LRQGDIVAIPSGAAHWCYN-DGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGVPRSGEQ 205
Query  142  NQPS------FLSGFSKNILEAAFNTEYEEIEKVLLEEQEQKSQHRRSLRDKRQEITNED 195
             Q +       +  F   +L  AFN   E I ++  EE+E     R  +   R+ +T   
Sbjct  206  EQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQSEEEE-----RGLIVMARERMT--- 257
Query  196  VIVKVSREQIEELSKNAKSSSKKSVSSESEPF--NLRSRNP--IYSNKFGKFFEITPEKN 251
              V+   E+ E+  +  +  +    +  +  F  N+ SR    I+S + G+   +   K 
Sbjct  258  -FVRPDEEEGEQEHRGRQLDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKL 316
Query  252  PQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREEND 311
            P L+ +D+      +   +L+ P+++     IV V  G    ++V +  +     R    
Sbjct  317  PILKYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQG 376
Query  312  E 312
            E
Sbjct  377  E 377

Sequence Alignment: 34. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 35.9 bits 130,  Expect = 0.005
 Identities = 53/157 33%, Positives = 86/157 54%, Gaps = 24/157 15%
Query  228  NLRSRNPIYSNKFGKFF-EITPEKNPQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTV 286
            NLR+++P+   +    F E+  + N ++Q   + +    I+   LLLP + S A  ++ V
Sbjct  52   NLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLPGF-SNAPKLIFV 110
Query  287  NEGKGDFELVGQRNENQQEQREENDEEEGQEEETTKQVQRYRAR-LSPGDVLVIPAG--H 343
             +G   F + G       E  +  D    Q   +  + Q  + R +  GD+LV+PAG  H
Sbjct  111  AQG---FGIRGIAIPGCAETYQ-TDLRRSQSAGSAFKDQHQKIRPFREGDLLVVPAGVSH 166
Query  344  PVAINASSDLNLIGFGINAKN--NQ-----RNF-LAGEEDNVISQIQRPVKELAFPGSSR 395
             +     SDL LI F  + +N  NQ     R F LAG  +    Q++R V+E  +  SSR
Sbjct  167  WMYNRGQSDLVLIVFA-DTRNVANQIDPYLRKFYLAGRPE----QVERGVEE--WERSSR 219
Query  396  E 396
            +
Sbjct  220  K 220

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.