The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCK
MVHSDSPYGENLMFGSGAISWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTT
SVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY
Sequence Info Allergen Name Length Opt Bits Score E Value
AAU15051 Cyn d 24.0101 153 1096 275.4 4.9e-76
AVD29824 Art ca 2.0101 163 399 104.7 1.2e-24
A0A2L1DGQ3 Art ar 2.0101 163 399 104.7 1.2e-24
AVD29826 Art la 2.0101 163 399 104.7 1.2e-24
AVD29827 Art si 2.0101 163 399 104.7 1.2e-24
AVD29825 Art gm 2.0101 163 397 104.2 1.7e-24
AVD29822 Art an 2.0101 163 397 104.2 1.7e-24
XP_007199020 Pru p 9.0101 161 359 94.9 1.1e-21
QEA69430 Sco m 5.0101 210 230 63.2 4.8e-12
Q05109 Pol a 5 209 225 62.0 1.1e-11
P35759 Pol e 5.0101 205 219 60.5 3e-11
P81657 Vesp m 5 202 213 59.1 8.2e-11
P35782 Vesp c 5 202 213 59.1 8.2e-11
P35780 Pol f 5 205 213 59.1 8.4e-11
Q05108 Dol a 5 203 212 58.8 9.8e-11
AAT95009 Pol e 5.0101 226 212 58.8 1.1e-10
P35781 Vesp c 5 202 211 58.6 1.2e-10
P0DMB9 Vesp v 5.0101 202 205 57.1 3.2e-10
P81656 Pol d 5 206 202 56.4 5.5e-10
P35784 Ves g 5 204 201 56.1 6.4e-10
P83377 Pol g 5 206 199 55.7 9.1e-10
P35785 Ves p 5 204 198 55.4 1.1e-09
C0HJV9 Poly p 5.0101 206 198 55.4 1.1e-09
Q7Z156 Poly s 5.0101 207 198 55.4 1.1e-09
AAA28302 Dol m 5.02 212 194 54.4 2.2e-09
P10737 Dol m 5.02 215 194 54.4 2.2e-09
P35783 Ves f 5 204 191 53.7 3.5e-09
P10736 Dol m 5.0101 227 191 53.7 4e-09
P35760 Ves m 5 204 190 53.5 4.1e-09
P35787 Ves vi 5 206 189 53.2 5e-09
P35786 Ves s 5 205 187 52.7 6.9e-09
Q05110 Ves v 5 227 186 52.4 9.3e-09
P86686 Poly p 5.0102 207 184 52.0 1.2e-08
AAY32926 Sol g 3.0101 70 141 41.8 4.5e-06
P35779 Sol r 3 211 145 42.4 8.9e-06
P35778 Sol i 3 234 142 41.7 1.7e-05
C0ITL3 Pac c 3.0101 199 128 38.3 0.00015
AAF65314 Cte f 2 264 112 34.3 0.0032
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 275.4 bits 1096,  Expect = 5e-76
 Identities = 153/153 100%, Positives = 153/153 100%, Gaps = 0/153 0%
Query  1    STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCK 60
            STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCK
Sbjct  1    STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCK 60
Query  61   MVHSDSPYGENLMFGSGAISWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTT 120
            MVHSDSPYGENLMFGSGAISWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTT
Sbjct  61   MVHSDSPYGENLMFGSGAISWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTT 120
Query  121  SVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY 153
            SVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY
Sbjct  121  SVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY 153

Sequence Alignment: 2. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 104.7 bits 399,  Expect = 1e-24
 Identities = 59/128 46%, Positives = 79/128 61%, Gaps = 6/128 4%
Query  20   DILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAI 79
            D ++ HN  R    + PL W+  LAK +Q +AE++   DC ++HSD   GEN+    GAI
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTP-DCSLIHSDR-CGENM--AQGAI 91
Query  80   SWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMC 139
            +    V  W DE+  Y Y  N C   KMCGHYT +VW ++  VGCGR LC +    +I+C
Sbjct  92   NGSMAVQLWLDERLDYDYNENKC--IKMCGHYTQIVWANSERVGCGRALCSNGWAYIIVC 149
Query  140  SYWPPGNYENQKPY 153
            +Y PPGN   QKPY
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 3. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 104.7 bits 399,  Expect = 1e-24
 Identities = 59/128 46%, Positives = 79/128 61%, Gaps = 6/128 4%
Query  20   DILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAI 79
            D ++ HN  R    + PL W+  LAK +Q +AE++   DC ++HSD   GEN+    GAI
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTP-DCSLIHSDR-CGENM--AQGAI 91
Query  80   SWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMC 139
            +    V  W DE+  Y Y  N C   KMCGHYT +VW ++  VGCGR LC +    +I+C
Sbjct  92   NGSMAVQLWLDERLDYDYNENKC--IKMCGHYTQIVWANSERVGCGRALCSNGWAYIIVC 149
Query  140  SYWPPGNYENQKPY 153
            +Y PPGN   QKPY
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 4. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 104.7 bits 399,  Expect = 1e-24
 Identities = 59/128 46%, Positives = 79/128 61%, Gaps = 6/128 4%
Query  20   DILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAI 79
            D ++ HN  R    + PL W+  LAK +Q +AE++   DC ++HSD   GEN+    GAI
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTP-DCSLIHSDR-CGENM--AQGAI 91
Query  80   SWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMC 139
            +    V  W DE+  Y Y  N C   KMCGHYT +VW ++  VGCGR LC +    +I+C
Sbjct  92   NGSMAVQLWLDERLDYDYNENKC--IKMCGHYTQIVWANSERVGCGRALCSNGWAYIIVC 149
Query  140  SYWPPGNYENQKPY 153
            +Y PPGN   QKPY
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 5. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 104.7 bits 399,  Expect = 1e-24
 Identities = 60/128 46%, Positives = 79/128 61%, Gaps = 6/128 4%
Query  20   DILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAI 79
            D ++ HN  R    + PL W+  LAK +Q +AE++   DC +VHSD   GEN+    GAI
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAEARTA-DCSLVHSDR-CGENM--AQGAI 91
Query  80   SWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMC 139
            +    V  W DE+  Y Y  N C   KMCGHYT +VW ++  VGCGR LC +    +I+C
Sbjct  92   NGSMAVQLWLDERLDYDYNENKC--IKMCGHYTQIVWANSERVGCGRALCSNGWAYIIVC 149
Query  140  SYWPPGNYENQKPY 153
            +Y PPGN   QKPY
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 6. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 104.2 bits 397,  Expect = 2e-24
 Identities = 60/128 46%, Positives = 78/128 60%, Gaps = 6/128 4%
Query  20   DILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAI 79
            D ++ HN  R    + PL W+  LAK +Q +AE++   DC +VHSD   GEN+    GAI
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTP-DCSLVHSDR-CGENM--AQGAI 91
Query  80   SWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMC 139
            +    V  W DE+  Y Y  N C   KMCGHYT +VW +T  VGCGR LC +    + +C
Sbjct  92   NGSMAVQLWLDERLDYDYNENKC--IKMCGHYTQIVWANTERVGCGRALCSNGWAYITVC 149
Query  140  SYWPPGNYENQKPY 153
            +Y PPGN   QKPY
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 7. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 104.2 bits 397,  Expect = 2e-24
 Identities = 60/128 46%, Positives = 78/128 60%, Gaps = 6/128 4%
Query  20   DILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAI 79
            D ++ HN  R    + PL W+  LAK +Q +AE++   DC +VHSD   GEN+    GAI
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTP-DCSLVHSDR-CGENM--AQGAI 91
Query  80   SWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMC 139
            +    V  W DE+  Y Y  N C   KMCGHYT +VW +T  VGCGR LC +    + +C
Sbjct  92   NGSMAVQLWLDERLDYDYNENKC--IKMCGHYTQIVWANTERVGCGRALCSNGWAYITVC 149
Query  140  SYWPPGNYENQKPY 153
            +Y PPGN   QKPY
Sbjct  150  NYDPPGNVVGQKPY 163

Sequence Alignment: 8. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 94.9 bits 359,  Expect = 1e-21
 Identities = 57/137 41%, Positives = 83/137 60%, Gaps = 4/137 2%
Query  13   LNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENL 72
            ++ + I   + EHN  R +    PL WNTTLA+++Q+YA+ ++  DC M HS   +GENL
Sbjct  25   ISKEEIDGFVEEHNKARKEVGNKPLKWNTTLAQYAQEYADKRVG-DCAMEHSMGRWGENL 83
Query  73   MFGSGAISWKTTVDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDK 132
              G G +S       W  EK+ Y   SN C + + CGHY AVVW  TT VGCG   C++ 
Sbjct  84   ASGDG-MSGAAATKYWVTEKEFYDEKSNKCVKDE-CGHYLAVVWGKTTEVGCGISKCNNG 141
Query  133  KDTMIMCSYWPPGNYENQKPY 153
            ++  ++CSY P    E+++PY
Sbjct  142  QN-YVVCSYDPMYQPEDERPY 161

Sequence Alignment: 9. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 63.2 bits 230,  Expect = 5e-12
 Identities = 47/140 33%, Positives = 73/140 52%, Gaps = 8/140 5%
Query  13   LNDKAIQDILN-EHNMFRAKEHVPPLTWNTTLAKFSQDYAESKL-KKDCKMVHSDSPY-- 68
            L++K  Q + N +++   +  ++  L W+  +A  +Q  AE+ + +   K +   S Y  
Sbjct  42   LHNKKRQTVANGQQSGQPSAANMKELHWDDQIAANAQRSAETCVFQHTAKNLRKTSKYSY 101
Query  69   -GENLMFGSGAISWKTTVDTWSDEKKSYHYG--SNTCDQGKMCGHYTAVVWKDTTSVGCG 125
             GEN+  GS       +V+ W DE K        +    G M GHYT +VW +T ++GCG
Sbjct  102  LGENIYMGSYPDPIPRSVNAWYDEVKDVTPAVVKSFRSGGPMIGHYTQMVWANTEALGCG 161
Query  126  RVLCDDKKDTMIMCSYWPPGNYENQKPY 153
             V   DK +T I C Y P GNY  +  Y
Sbjct  162  LVTASDK-NTYIFCQYGPSGNYPGEPIY 188

Sequence Alignment: 10. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 62.0 bits 225,  Expect = 1e-11
 Identities = 47/141 33%, Positives = 77/141 54%, Gaps = 26/141 18%
Query  12   GLNDKAIQDILNEHNMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK 54
            G  ++  + I++EHN FR K                   +  L WN  LA  +Q +A   
Sbjct  41   GPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQC 100
Query  55   --LKKD-CKMVHSDSPYGENLMF--GSGAISWKTTVDTWSDEKKSYHYGSNTCDQG-KMC 108
              L  D C+   +  P G+N+ +  GS      + +  W +E K ++Y +    Q     
Sbjct  101  QFLVHDKCRNT-AKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKI 159
Query  109  GHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYENQKPY 153
            GHYT +VW  T  +GCG  + + ++ ++  ++C+Y P GNY  Q PY
Sbjct  160  GHYTQMVWGKTKEIGCGSLKYMENNMQNHYLICNYGPAGNYLGQLPY 206

Sequence Alignment: 11. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 60.5 bits 219,  Expect = 3e-11
 Identities = 46/141 32%, Positives = 76/141 53%, Gaps = 26/141 18%
Query  12   GLNDKAIQDILNEHNMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK 54
            G  ++  + I++EHN FR K                   +  L WN  LA  +Q +A   
Sbjct  37   GPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQC 96
Query  55   --LKKD-CKMVHSDSPYGENLMFGSGAI--SWKTTVDTWSDEKKSYHYGSNTCDQG-KMC 108
              L  D C+   +  P G+N+ +  G+      + +  W +E K ++Y +    Q     
Sbjct  97   QFLVHDKCRNT-AKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKI 155
Query  109  GHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYENQKPY 153
            GHYT +VW  T  +GCG  + + +  ++  ++C+Y P GNY  Q PY
Sbjct  156  GHYTQMVWGKTKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQLPY 202

Sequence Alignment: 12. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 59.1 bits 213,  Expect = 8e-11
 Identities = 54/141 38%, Positives = 80/141 56%, Gaps = 27/141 19%
Query  11   NGLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYA-E 52
            +GL      +IL +HN FR K              PP      L WN  LA+ +Q +A +
Sbjct  34   SGLTKAEKLEILKQHNEFRQKVARGLETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQ 93
Query  53   SKLKKD-CKMVHSDSPYGENLMF-GSGAISWKTT---VDTWSDEKKSYHYGSNTCDQGKM 107
                 D C+     S  G+N+   GS A S+ +    V  W+DE K+Y+YGS T ++   
Sbjct  94   CDYGHDVCRNTAKYS-VGQNIAENGSTAASFASVSNMVQMWADEVKNYQYGS-TKNKLIE 151
Query  108  CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153
             GHYT +VW  T  +GCG +  + +      ++C+Y P GN  N+  Y
Sbjct  152  VGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNIGNEPIY 199

Sequence Alignment: 13. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 59.1 bits 213,  Expect = 8e-11
 Identities = 53/141 37%, Positives = 76/141 53%, Gaps = 27/141 19%
Query  11   NGLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYA-E 52
            +GL  +   +IL +HN FR K              PP      L WN  LA+ +Q +A +
Sbjct  34   SGLTKQENLEILKQHNEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQ 93
Query  53   SKLKKD-CKMVHSDSPYGENLMFGSGA----ISWKTTVDTWSDEKKSYHYGSNTCDQGKM 107
                 D C+     S  G+N+  GS +    ++    V  W DE K Y+YGS      K+
Sbjct  94   CNYGHDNCRNSAKYS-VGQNIAEGSTSADNFVNVSNMVKMWEDEVKDYQYGSPKNKLNKV 152
Query  108  CGHYTAVVWKDTTSVGCGR--VLCDDKKDTMIMCSYWPPGNYENQKPY 153
             GHYT +VW  T  +GCG    + D      ++C+Y P GN  N+  Y
Sbjct  153  -GHYTQMVWAKTKEIGCGSEDYIEDGWHRHYLVCNYGPAGNVGNEPIY 199

Sequence Alignment: 14. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 59.1 bits 213,  Expect = 8e-11
 Identities = 49/140 35%, Positives = 78/140 55%, Gaps = 28/140 20%
Query  12   GLNDKAIQDILNEHNMFRAK-------EHVP-P---------LTWNTTLAKFSQDYAESK 54
            G  ++  + I+NEHN FR K          P P         L WN  LA  +Q +A   
Sbjct  37   GPTEEEKKLIVNEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQC 96
Query  55   --LKKD-CKMVHSDSPYGENLMFGSGAI--SWKTTVDTWSDEKKSYHYGSNTCDQ--GKM 107
              L  D C+   +    G+N+ +  G+      + +  W +E K ++Y      Q  GK+
Sbjct  97   QILVHDKCRNT-AKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKV 155
Query  108  CGHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYENQKPY 153
             GHYT ++W  T  +GCG  + + ++ +   ++C+Y P GNY  Q PY
Sbjct  156  -GHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPY 202

Sequence Alignment: 15. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 58.8 bits 212,  Expect = 1e-10
 Identities = 52/141 36%, Positives = 76/141 53%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYA-ES 53
            G+ +    +I+  HN FR K              PP      L WN  LAK +Q +A + 
Sbjct  34   GVTNDEKNEIVKRHNEFRQKVAQGLETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQC 93
Query  54   KLKKD-CKMVHSDSPYGENLMFGSGA-ISWKTT---VDTWSDEKKSYHYGSNTCDQG-KM 107
             +  D C+   +  P G+N+   S    S++T    +  W DE K Y+   +        
Sbjct  94   NFGHDQCRNT-AKYPVGQNVAIASTTGNSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSK 152
Query  108  CGHYTAVVWKDTTSVGCGRV-LCDDKKDT-MIMCSYWPPGNYENQKPY 153
             GHYT +VW  T  +GCG V   ++K  T  ++C+Y P GNY NQ  Y
Sbjct  153  VGHYTQMVWGKTKEIGCGSVKYIENKWHTHYLVCNYGPAGNYMNQPVY 200

Sequence Alignment: 16. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 58.8 bits 212,  Expect = 1e-10
 Identities = 45/140 32%, Positives = 75/140 53%, Gaps = 26/140 18%
Query  12   GLNDKAIQDILNEHNMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK 54
            G  ++  + I++EHN FR K                   +  L WN  LA  +Q +A   
Sbjct  58   GPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQC 117
Query  55   --LKKD-CKMVHSDSPYGENLMFGSGAI--SWKTTVDTWSDEKKSYHYGSNTCDQG-KMC 108
              L  D C+   +  P G+N+ +  G+      + +  W +E K ++Y +    Q     
Sbjct  118  QFLVHDKCRNT-AKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKI 176
Query  109  GHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYENQKP 152
            GHYT +VW  T  +GCG  + + +  ++  ++C+Y P GNY  Q P
Sbjct  177  GHYTQMVWGKTKEIGCGSLKYMENKMQNHYLICNYGPAGNYLGQLP 222

Sequence Alignment: 17. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 58.6 bits 211,  Expect = 1e-10
 Identities = 54/139 38%, Positives = 78/139 56%, Gaps = 31/139 22%
Query  11   NGLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYA-E 52
            +GL  +   +IL +HN FR K              PP      L WN  LA+ +Q +A +
Sbjct  34   SGLTKQENLEILKQHNEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQ 93
Query  53   SKLKKD-CKMVHSDSPYGENLMFGS------GAISWKTTVDTWSDEKKSYHYGSNTCDQG 105
                 D C+     S  G+N+  GS      G++S    V  W DE K Y+YGS      
Sbjct  94   CNYGHDNCRNSAKYS-VGQNIAEGSTTADNFGSVS--NMVKMWEDEVKDYQYGSPKNKLN 150
Query  106  KMCGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153
            K+ GHYT +VW  T  +GCG +  + +      ++C+Y P GN  N+  Y
Sbjct  151  KV-GHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNVGNEPIY 199

Sequence Alignment: 18. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 57.1 bits 205,  Expect = 3e-10
 Identities = 51/137 37%, Positives = 72/137 52%, Gaps = 35/137 25%
Query  11   NGLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYAES 53
            +GL      +IL +HN FR K              PP      L WN  LA+ +Q +A  
Sbjct  34   SGLTKAEKLEILKQHNEFRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWA-- 91
Query  54   KLKKDCKMVHSDSPYGENLMFGSGAISWKTT----------VDTWSDEKKSYHYGSNTCD 103
                 CK  H +       + G       TT          V  WSDE K Y+YGS+  +
Sbjct  92   ---SQCKYGHDNCRNTAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQYGSSK-N 147
Query  104  QGKMCGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153
            +    GHYT +VW  T  +GCG +  + +      ++C+Y P GN  N+  Y
Sbjct  148  KLNDVGHYTQMVWAKTKEIGCGNIKYIENGWHHHYLVCNYGPAGNIGNEPIY 199

Sequence Alignment: 19. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 56.4 bits 202,  Expect = 5e-10
 Identities = 40/122 32%, Positives = 67/122 54%, Gaps = 12/122 9%
Query  30   AKEHVPPLTWNTTLAKFSQDYAESK--LKKD-CKMVHSDSPYGENLMFGSGAISWKTT-- 84
            A  ++  L WN  LAK +Q +A     L  D C+        G+N+ +   +  + +   
Sbjct  72   AASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEK-YQVGQNIAYAGSSNHFPSVTK 130
Query  85   -VDTWSDEKKSYHYGSNTCDQ--GKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTM--IMC 139
             +  W +E K ++Y +   ++  GK+ GHYT +VW +T  VGCG +   +K   +  ++C
Sbjct  131  LIQLWENEVKDFNYNTGITNKNFGKV-GHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLIC 189
Query  140  SYWPPGNYENQKPY 153
            +Y P GNY  Q  Y
Sbjct  190  NYGPAGNYLGQPIY 203

Sequence Alignment: 20. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 56.1 bits 201,  Expect = 6e-10
 Identities = 54/141 38%, Positives = 79/141 56%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAK-----------EHVPP------LTWNTTLAKFSQDYA-ES 53
            GL  +  QDIL EHN FR K              PP      L W+  LA  +Q +A + 
Sbjct  35   GLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQC 94
Query  54   KLKKD-CKMVHSDSPYGENL-MFGSGAISWKTTVDT---WSDEKKSYHYGSNTCDQGKM- 107
            +   D C+ V +  P G+N+ + GS A  +   V     W DE K Y+      +   + 
Sbjct  95   QYGHDTCRDV-AKYPVGQNVALTGSTAAKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLK 153
Query  108  CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153
             GHYT +VW +T  VGCG +  + D      ++C+Y P GN+ N++ Y
Sbjct  154  IGHYTQMVWANTKEVGCGSIKYIQDKWHKHYLVCNYGPSGNFGNEELY 201

Sequence Alignment: 21. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 55.7 bits 199,  Expect = 9e-10
 Identities = 39/122 31%, Positives = 66/122 54%, Gaps = 12/122 9%
Query  30   AKEHVPPLTWNTTLAKFSQDYAESK--LKKD-CKMVHSDSPYGENLMFGSGAISWKTT-- 84
            A  ++  L WN   AK +Q +A     L  D C+        G+N+ +   +  + +   
Sbjct  72   AASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEK-YQVGQNIAYAGSSNHFPSVTK 130
Query  85   -VDTWSDEKKSYHYGSNTCDQ--GKMCGHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMC 139
             +  W +E K ++Y +   ++  GK+ GHYT +VW +T  VGCG  + +  + K   ++C
Sbjct  131  LIQLWENEVKDFNYNTGITNKNFGKV-GHYTQMVWGNTKEVGCGSLKYVEKNMKIHYLIC 189
Query  140  SYWPPGNYENQKPY 153
            +Y P GNY  Q  Y
Sbjct  190  NYGPAGNYLGQPIY 203

Sequence Alignment: 22. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 55.4 bits 198,  Expect = 1e-09
 Identities = 53/141 37%, Positives = 79/141 56%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAK-----------EHVPP------LTWNTTLAKFSQDYA-ES 53
            GL  +  QDIL EHN FR K              PP      L WN  LA  +Q +A + 
Sbjct  35   GLTKEEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQC 94
Query  54   KLKKD-CKMVHSDSPYGENL-MFGSGAISWKTTVDT---WSDEKKSYHYGSNTCDQG-KM 107
            +   D C+ V +  P G+N+ + GS A  +   V     W DE K Y+      +     
Sbjct  95   QYGHDTCRDV-AKYPVGQNVALTGSTADKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNK 153
Query  108  CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153
             GHYT +VW +T  +GCG +  + ++     ++C+Y P GN+ N++ Y
Sbjct  154  IGHYTQMVWANTKEIGCGSIKYIQNEWHKHYLVCNYGPSGNFGNEELY 201

Sequence Alignment: 23. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 55.4 bits 198,  Expect = 1e-09
 Identities = 48/141 34%, Positives = 74/141 52%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAK-------EHVP-P---------LTWNTTLAKFSQDYAESK 54
            G+ ++  + I++EHN FR K          P P         L WN  LA  +Q +A   
Sbjct  37   GVTEEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQC 96
Query  55   ---LKKDCKMVHSDSPYGENLMFGSGAISWKTTVDT---WSDEKKSYHYGSN-TCDQGKM 107
               +   C+   +    G+N+ + +   ++   V     W +E K ++Y    T +    
Sbjct  97   QFFVHDKCRNT-AQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGITKENFSK 155
Query  108  CGHYTAVVWKDTTSVGCGRVLCDDK--KDTMIMCSYWPPGNYENQKPY 153
             GHYT VVW  T  VGCG +   +K  K   ++C+Y P GNY  Q  Y
Sbjct  156  VGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMGQPIY 203

Sequence Alignment: 24. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 55.4 bits 198,  Expect = 1e-09
 Identities = 48/141 34%, Positives = 74/141 52%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAK-------EHVP-P---------LTWNTTLAKFSQDYAESK 54
            G+ ++  + I++EHN FR K          P P         L WN  LA  +Q +A   
Sbjct  38   GVTEEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQC 97
Query  55   ---LKKDCKMVHSDSPYGENLMFGSGAISWKTTVDT---WSDEKKSYHYGSN-TCDQGKM 107
               +   C+   +    G+N+ + +   ++   V     W +E K ++Y    T +    
Sbjct  98   QFFVHDKCRNT-AQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGITKENFAK 156
Query  108  CGHYTAVVWKDTTSVGCGRVLCDDK--KDTMIMCSYWPPGNYENQKPY 153
             GHYT VVW  T  VGCG +   +K  K   ++C+Y P GNY  Q  Y
Sbjct  157  VGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMGQPIY 204

Sequence Alignment: 25. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 54.4 bits 194,  Expect = 2e-09
 Identities = 46/143 32%, Positives = 76/143 53%, Gaps = 28/143 19%
Query  10   LNGLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYA- 51
            ++G+++    +I+N HN FR K              PP      L WN  LAK +Q +A 
Sbjct  43   VHGVSNDEKNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTWAN 102
Query  52   ESKLKKD-CKMVHSDSPYGENLMF----GSGAISWKTTVDTWSDEKKSYHYGSNTCDQGK 106
            +  +  D C+        G+N+      G+   +    ++ W +E K ++    T     
Sbjct  103  QCSFGHDQCRNTEK-YQVGQNVAIASTTGNSYATMSKLIEMWENEVKDFNPKKGTMGDNN 161
Query  107  MC--GHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153
                GHYT +VW  T  +GCG V  + ++     ++C+Y P GNY +Q  Y
Sbjct  162  FSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 26. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 54.4 bits 194,  Expect = 2e-09
 Identities = 46/143 32%, Positives = 76/143 53%, Gaps = 28/143 19%
Query  10   LNGLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYA- 51
            ++G+++    +I+N HN FR K              PP      L WN  LAK +Q +A 
Sbjct  43   VHGVSNDEKNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTWAN 102
Query  52   ESKLKKD-CKMVHSDSPYGENLMF----GSGAISWKTTVDTWSDEKKSYHYGSNTCDQGK 106
            +  +  D C+        G+N+      G+   +    ++ W +E K ++    T     
Sbjct  103  QCSFGHDQCRNTEK-YQVGQNVAIASTTGNSYATMSKLIEMWENEVKDFNPKKGTMGDNN 161
Query  107  MC--GHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153
                GHYT +VW  T  +GCG V  + ++     ++C+Y P GNY +Q  Y
Sbjct  162  FSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 27. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 53.7 bits 191,  Expect = 3e-09
 Identities = 53/141 37%, Positives = 78/141 55%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAK-----------EHVPP------LTWNTTLAKFSQDYA-ES 53
            GL  +  QDIL EHN FR K              PP      L WN  LA  +Q +A + 
Sbjct  35   GLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQC 94
Query  54   KLKKD-CKMVHSDSPYGENL-MFGSGAISWKTTVDT---WSDEKKSYHYGSNTCDQGKM- 107
            +   D C+ + +    G+N+ + GS A  +   V     W DE K Y+          + 
Sbjct  95   QYGHDTCRDI-AKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLK 153
Query  108  CGHYTAVVWKDTTSVGCGRVLCDDKK--DTMIMCSYWPPGNYENQKPY 153
             GHYT +VW +T  VGCG +    +K     ++C+Y P GN++N++ Y
Sbjct  154  TGHYTQMVWANTKEVGCGSIKFIQEKWHKHYLVCNYGPSGNFQNEELY 201

Sequence Alignment: 28. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 53.7 bits 191,  Expect = 4e-09
 Identities = 48/141 34%, Positives = 70/141 49%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFR---AKE--------HVPP------LTWNTTLAKFSQDYAESK 54
            GL +    +IL  HN FR   AK           PP      L WN  LAK +Q +A   
Sbjct  58   GLTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQC 117
Query  55   L--KKDCKMVHSDSPYGENLMFGSGAISW----KTTVDTWSDEKKSYHYGSNTCDQG-KM 107
                 DC+   +    G+N+   S   +        +  W DE   ++Y     +   + 
Sbjct  118  DFNHDDCRNT-AKYQVGQNIAISSTTATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRK 176
Query  108  CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153
             GHYT +VW  T  +GCG +  + D+     ++C+Y P GN  NQ  Y
Sbjct  177  VGHYTQMVWGKTKEIGCGSIKYIEDNWYTHYLVCNYGPGGNDFNQPIY 224

Sequence Alignment: 29. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 53.5 bits 190,  Expect = 4e-09
 Identities = 52/141 36%, Positives = 80/141 56%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAK-----------EHVPP------LTWNTTLAKFSQDYA-ES 53
            GL  +  QDIL EHN FR K              PP      L W+  LA  +Q +A + 
Sbjct  35   GLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQC 94
Query  54   KLKKD-CKMVHSDSPYGENL-MFGSGAISWKTTVDT---WSDEKKSYHYGSNTCDQGKM- 107
            +   D C+ V +    G+N+ + GS A  +   V     W DE K Y+      +   + 
Sbjct  95   QYGHDTCRDV-AKYQVGQNVALTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLK 153
Query  108  CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153
             GHYT +VW +T  VGCG +  + ++     ++C+Y P GN++N++ Y
Sbjct  154  IGHYTQMVWANTKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEELY 201

Sequence Alignment: 30. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 53.2 bits 189,  Expect = 5e-09
 Identities = 52/141 36%, Positives = 73/141 51%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYA-ES 53
            GL +   Q+IL  HN FR K              PP      L WN  LA  +Q +A + 
Sbjct  37   GLTEAEKQEILKVHNDFRQKVAKGLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQC 96
Query  54   KLKKD-CKMVHSDSPYGENLMFGSGAI----SWKTTVDTWSDEKKSYHYGSN-TCDQGKM 107
                D CK      P G+N+   S       S    V  W +E K ++     + +  K 
Sbjct  97   NYGHDTCKDTEK-YPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKK 155
Query  108  CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153
             GHYT +VW  T  +GCG V  + D+     ++C+Y P GN+ N+K Y
Sbjct  156  TGHYTQMVWAKTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLY 203

Sequence Alignment: 31. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 52.7 bits 187,  Expect = 7e-09
 Identities = 52/141 36%, Positives = 76/141 53%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYA-ES 53
            G+     Q+IL  HN FR K              PP      L WN  LA  +Q +A + 
Sbjct  36   GVTQAEKQEILKIHNDFRNKVARGLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQC 95
Query  54   KLKKD-CKMVHSDSPYGENLMFGSG-AISWKTT---VDTWSDEKKSYHYG-SNTCDQGKM 107
            K   D CK   +    G+N+   S  A  ++     V  W +E K ++   S   ++ K 
Sbjct  96   KYGHDTCKDT-TKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKK 154
Query  108  CGHYTAVVWKDTTSVGCGRV-LCDDKKDT-MIMCSYWPPGNYENQKPY 153
             GHYT +VW  T  +GCG +   D+   T  ++C+Y P GN+ NQ+ Y
Sbjct  155  IGHYTQMVWAKTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQEVY 202

Sequence Alignment: 32. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 52.4 bits 186,  Expect = 9e-09
 Identities = 54/141 38%, Positives = 77/141 54%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAK-----------EHVPP------LTWNTTLAKFSQDYA-ES 53
            GL  +  QDIL EHN FR K              PP      L WN  LA  +Q +A + 
Sbjct  58   GLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQC 117
Query  54   KLKKD-CKMVHSDSPYGENL-MFGSGAISWKTTVDT---WSDEKKSYHYGSNTCDQGKM- 107
            +   D C+ V +    G+N+ + GS A  +   V     W DE K Y+          + 
Sbjct  118  QYGHDTCRDV-AKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLK 176
Query  108  CGHYTAVVWKDTTSVGCGRVLCDDKK--DTMIMCSYWPPGNYENQKPY 153
             GHYT +VW +T  VGCG +    +K     ++C+Y P GN+ N++ Y
Sbjct  177  TGHYTQMVWANTKEVGCGSIKYIQEKWHKHYLVCNYGPSGNFMNEELY 224

Sequence Alignment: 33. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 52.0 bits 184,  Expect = 1e-08
 Identities = 46/141 32%, Positives = 74/141 52%, Gaps = 27/141 19%
Query  12   GLNDKAIQDILNEHNMFRAK-------EHVP-P---------LTWNTTLAKFSQDYAESK 54
            G+ ++  + I++EHN FR K          P P         L WN  LA  +Q +A   
Sbjct  38   GVTEEEKKLIVDEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQC 97
Query  55   ---LKKDCKMVHSDSPYGENLMFGSGAISWKTTVDT---WSDEKKSYHYGSN-TCDQGKM 107
               +   C+   +    G+N+ + +   ++   V     W +E K ++Y +  T +    
Sbjct  98   QFFVHDKCRNT-AQYQVGQNIAYSASTAAYPGVVKLIVLWENEVKDFNYNTGITKENFAK 156
Query  108  CGHYTAVVWKDTTSVGCGRVLCDDK--KDTMIMCSYWPPGNYENQKPY 153
             GHYT VVW  T  VGCG +   +K  K   ++C+Y P GN    + Y
Sbjct  157  VGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNVLGAQIY 204

Sequence Alignment: 34. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 41.8 bits 141,  Expect = 4e-06
 Identities = 19/45 42%, Positives = 27/45 60%, Gaps = 3/45 6%
Query  109  GHYTAVVWKDTTSVGCGRVLC---DDKKDTMIMCSYWPPGNYENQKPY 153
            GHYT +VW  T  +GCGR++    D+     ++C+Y P GN    K Y
Sbjct  19   GHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIY 66

Sequence Alignment: 35. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 42.4 bits 145,  Expect = 9e-06
 Identities = 48/141 34%, Positives = 80/141 56%, Gaps = 31/141 21%
Query  12   GLNDKAIQDILNEHNMFR-----AKE------------HVPPLTWNTTLAKFSQDYA-ES 53
            G+ D     I+N+HN +R      KE             +P LTW+  LA  +Q +A + 
Sbjct  37   GFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQC 96
Query  54   KLKKD-CKMVHSDSPYGENLMFGSGAISWKTTVDT----WSDEKKSY--HYGSNTCDQGK 106
             ++ D C+ V   +  G+N+   S +   K+T+      W +E K +   + S+    G 
Sbjct  97   TFEHDACRNVERFA-VGQNIAATSSSGKNKSTLSDMILLWYNEVKDFDNRWISSFPSDGN 155
Query  107  M---CGHYTAVVWKDTTSVGCGRVLC--DDKKDTMIMCSYWPPGNYENQKPY 153
            +    GHYT +VW  T  +GCGR++   D+     ++C+Y P GN    + Y
Sbjct  156  ILMHVGHYTQIVWAKTKKIGCGRIMFKEDNWNKHYLVCNYGPAGNVLGAQIY 207

Sequence Alignment: 36. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 41.7 bits 142,  Expect = 2e-05
 Identities = 48/134 35%, Positives = 76/134 56%, Gaps = 32/134 23%
Query  12   GLNDKAIQDILNEHNMFR-----AKE------------HVPPLTWNTTLAKFSQDYA-ES 53
            G+ D     I+N+HN +R      KE             +P LTW+  LA  +Q +A + 
Sbjct  59   GFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQC 118
Query  54   KLKKD-CKMVHSDSPYGENLMFGSGAISWKTT----VDTWSDEKKSYH---YGSNTCDQG 105
             ++ D C+ V      G+N+   S +   K+T    +  W +E K +      S   D  
Sbjct  119  TFEHDACRNVER-FAVGQNIAATSSSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDN 177
Query  106  KM--CGHYTAVVWKDTTSVGCGRVLC---DDKKDTMIMCSYWPPGN 146
             +   GHYT +VW  TT +GCGR++    D+     ++C+Y P GN
Sbjct  178  ILMKVGHYTQIVWAKTTKIGCGRIMFKEPDNWTKHYLVCNYGPAGN 223

Sequence Alignment: 37. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 38.3 bits 128,  Expect = 0.0001
 Identities = 42/116 36%, Positives = 61/116 52%, Gaps = 14/116 12%
Query  30   AKEHVPPLTWNTTLAKFSQDYA-ESKLKKD-CKMVHSDSPYGENL-MFGS---GAISWKT 83
            A  ++P LTW+  LA  +Q +  + K+  D C+ V      G+N+ M GS   G  +   
Sbjct  63   AASNMPDLTWDNELAAIAQRWVNQCKIGHDGCRNVER-YQVGQNIAMSGSTAKGPCNMNN 121
Query  84   TVDTWSDEKKSYHYG--SNTCDQGKMC---GHYTAVVWKDTTSVGCGRVLCDDKK--DTM 136
             V  W +E  + +    S+    G      GHYT +VW  TT VGCG +   D K     
Sbjct  122  LVQMWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCY 181
Query  137  IMCSYWPPGN 146
            + C+Y P GN
Sbjct  182  LACNYGPAGN 191

Sequence Alignment: 38. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 34.3 bits 112,  Expect = 0.003
 Identities = 45/124 36%, Positives = 65/124 52%, Gaps = 25/124 20%
Query  25   HNMFRAKEHVPPLTWNTTLAKFSQ-DYAESKLKKDC-KMVHSDSPYGENLMFGSGAIS-- 80
            H    AK  +P LTWN  LAK+++ +  + ++K DC K  H  +  G+NL F    +S  
Sbjct  95   HTPIAAK--MPNLTWNIALAKLAEYNVKQCEMKHDCAKTRHGHT--GQNLFFYGTTLSPI 150
Query  81   -----WKTTVDTWSDEKKSYHYG-----SNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCD 130
                  K  VD W  E K          +     GK  GHYT ++W +TT VGC      
Sbjct  151  KNSTIAKMAVDGWYAESKDTRLEDIKKLTTIYPNGKPIGHYTQLIWGNTTKVGCAVSTYK 210
Query  131  DKKD------TMIMCSYWPPGNYENQKPY 153
               +      T++ C+Y   GN   +  Y
Sbjct  211  KHSNGNMFNMTLVACNYRG-GNMLEEAVY 238

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.