The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Input Sequence

TCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIP
QFLGKGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNNEQLVVTGGN
VGNENDIFKIKKTDLVIRGMKNVYKLLHCPSHLECKNIGSNFKNGYPRLVTVNDEKDFIP
FVFIKA
Sequence Info Allergen Name Length Opt Bits Score E Value
O24383 Sola t 3.0101 186 1258 293.7 2.2e-81
P20347 Sola t 3.0102 222 1133 265.1 1e-72
P30941 Sola t 4 221 192 50.6 3.8e-08
P16348 Sola t 2 188 190 50.3 4.2e-08
CAA45723 Sola t 4 217 177 47.2 4e-07
AAB23482 Gly m TI 203 152 41.6 1.9e-05
AAB23483 Gly m TI 204 150 41.1 2.6e-05
AAB23464 Gly m TI 216 146 40.2 5.3e-05
CAA45777 Gly m TI 217 146 40.2 5.3e-05
P01071 Gly m TI 181 141 39.1 9.2e-05
CAA45778 Gly m TI 217 140 38.8 0.00014
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sola t 3.0101 Sequence ID: O24383

 Score = 293.7 bits 1258,  Expect = 2e-81
 Identities = 186/186 100%, Positives = 186/186 100%, Gaps = 0/186 0%
Query  1    TCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIP 60
            TCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIP
Sbjct  1    TCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIP 60
Query  61   QFLGKGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNNEQLVVTGGN 120
            QFLGKGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNNEQLVVTGGN
Sbjct  61   QFLGKGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNNEQLVVTGGN 120
Query  121  VGNENDIFKIKKTDLVIRGMKNVYKLLHCPSHLECKNIGSNFKNGYPRLVTVNDEKDFIP 180
            VGNENDIFKIKKTDLVIRGMKNVYKLLHCPSHLECKNIGSNFKNGYPRLVTVNDEKDFIP
Sbjct  121  VGNENDIFKIKKTDLVIRGMKNVYKLLHCPSHLECKNIGSNFKNGYPRLVTVNDEKDFIP 180
Query  181  FVFIKA 186
            FVFIKA
Sbjct  181  FVFIKA 186

Sequence Alignment: 2. Allergen Name: Sola t 3.0102 Sequence ID: P20347

 Score = 265.1 bits 1133,  Expect = 1e-72
 Identities = 168/186 90%, Positives = 175/186 94%, Gaps = 1/186 0%
Query  1    TCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIP 60
            TCHDDDNLVLPEVYDQDGNPLRIGERYII NPLLGAGAVYL NIGNLQCPNAVLQHMSIP
Sbjct  36   TCHDDDNLVLPEVYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMSIP 95
Query  61   QFLGKGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNNEQLVVTGGN 120
            QFLG+GTPVVF+RKSESDYGDVVR+MT VYIKFFVKTTKLCVD+TVWKVN+EQLVVTGG 
Sbjct  96   QFLGEGTPVVFVRKSESDYGDVVRVMTVVYIKFFVKTTKLCVDQTVWKVNDEQLVVTGGK 155
Query  121  VGNENDIFKIKKTDLVIRG-MKNVYKLLHCPSHLECKNIGSNFKNGYPRLVTVNDEKDFI 179
            VGNENDIFKI KTDLV  G  K VYKLLHCPSHL CKNIG NFKNGYPRLVTV+D+KDFI
Sbjct  156  VGNENDIFKIMKTDLVTPGGSKYVYKLLHCPSHLGCKNIGGNFKNGYPRLVTVDDDKDFI 215
Query  180  PFVFIKA 186
            PFVFIKA
Sbjct  216  PFVFIKA 222

Sequence Alignment: 3. Allergen Name: Sola t 4 Sequence ID: P30941

 Score = 50.6 bits 192,  Expect = 4e-08
 Identities = 57/166 34%, Positives = 82/166 49%, Gaps = 19/166 11%
Query  13   VYDQDGNPLRIGERYIIKNPLLGA--GAVYLDNIGNLQ--CPNAVLQHMSIPQFLGKGTP 68
            V D  G  L     Y I + + GA  G VYL    N    C N ++++ S       GTP
Sbjct  36   VLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNS--DVGPSGTP 93
Query  69   VVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNN------EQLVVTGGNVG 122
            V FI  S S +G  +     + I+F + T+KLCV  T+WKV +        L+ TGG +G
Sbjct  94   VRFIGSS-SHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIG 152
Query  123  N-ENDIFKIKKTDLVIRGMKN--VYKLLHCPSHLE---CKNIGSNFKNGYPRLVTVNDEK 176
              ++  FKI K+      +    V   + CP   +   C  +G   +NG  RL  V D  
Sbjct  153  QADSSWFKIVKSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDNP 212
Query  177  DFIPF 181
              + F
Sbjct  213  LDVSF 217

Sequence Alignment: 4. Allergen Name: Sola t 2 Sequence ID: P16348

 Score = 50.3 bits 190,  Expect = 4e-08
 Identities = 63/151 41%, Positives = 85/151 56%, Gaps = 38/151 25%
Query  10   LPE-VYDQDGNPLRIGERYIIKNPLLGA--GAVYLDNIGNLQ--CPNAVLQHMSIPQFLG 64
            LP+ V D +G  L     Y I +   GA  G VYL    N    CP+ V+++ S      
Sbjct  4    LPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNS--DVGP 61
Query  65   KGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNN------EQLVVTG 118
             GTPV FI  S   + D  +L+    I+F + T KLCV  T+WKV N        L+ TG
Sbjct  62   SGTPVRFIPLSGGIFED--QLLN---IQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETG 116
Query  119  GNVGN-ENDIFKIKKTDLVIRGMKNV-YKLLHCP-----------SHLECKNIGSNFKNG 165
            G +G  ++  FKI K       + N  Y LL+CP               C  +G   +NG
Sbjct  117  GTIGQADSSYFKIVK-------LSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNG 169
Query  166  YPRLVTVND 174
              RL  VN+
Sbjct  170  KRRLALVNE 178

Sequence Alignment: 5. Allergen Name: Sola t 4 Sequence ID: CAA45723

 Score = 47.2 bits 177,  Expect = 4e-07
 Identities = 55/162 33%, Positives = 80/162 49%, Gaps = 23/162 14%
Query  13   VYDQDGNPLRIGERYIIKNPLLGA--GAVYLDNIGNLQ--CPNAVLQHMSIPQFLGKGTP 68
            V D  G  L     Y I + + GA  G VYL    N    C N ++++ S       GTP
Sbjct  36   VLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNS--DVGPSGTP 93
Query  69   VVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNN------EQLVVTGGNVG 122
            V F     S +G  +     + I+F + T+KLCV  T+WKV +        L+ TGG +G
Sbjct  94   VRF-----SHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIG 148
Query  123  N-ENDIFKIKKTDLVIRGMKN--VYKLLHCPSHLE---CKNIGSNFKNGYPRLVTVNDEK 176
              ++  FKI K+      +    V   + CP   +   C  +G   +NG  RL  V D  
Sbjct  149  QADSSWFKIVKSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDNP 208
Query  177  DFIPF 181
              + F
Sbjct  209  LDVSF 213

Sequence Alignment: 6. Allergen Name: Gly m TI Sequence ID: AAB23482

 Score = 41.6 bits 152,  Expect = 2e-05
 Identities = 49/160 30%, Positives = 75/160 46%, Gaps = 17/160 10%
Query  13   VYDQDGNPLRIGERYIIKNPLLG-AGAVYLDNIGNLQCPNAVLQHMSIPQFLGKGTPVVF 71
            V D D +PL+ G  Y +   + G  G + +D+ G   CP  V+Q    P  L KG  +VF
Sbjct  28   VLDTDDDPLQNGGTYYMLPVMRGKGGGIEVDSTGKEICPLTVVQS---PNELDKGIGLVF 84
Query  72   IRKSESDYGDVVRLMTAVYIKFFVKTTKLCVD-ETVWK-VNNEQLVVTGGNVGNEND-IF 128
                 + +      ++  +  F V T  LC    T W  V  E L        +  D  F
Sbjct  85   TSPLHALFIAERYPLSIKFGSFAVIT--LCAGMPTEWAIVEREGLQAVKLAARDTVDGWF 142
Query  129  KIKKTDLVIRGMKNVYKLLHCPSHLE---CKNIGSNFKN-GYPRLVTVNDEKDFIPF 181
             I++    +    N YKL+ CP + E   C++IG    + G  RLV   ++   + F
Sbjct  143  NIER----VSREYNDYKLVFCPQQAEDNKCEDIGIQIDDDGIRRLVLSKNKPLVVQF 195

Sequence Alignment: 7. Allergen Name: Gly m TI Sequence ID: AAB23483

 Score = 41.1 bits 150,  Expect = 3e-05
 Identities = 53/160 33%, Positives = 76/160 47%, Gaps = 18/160 11%
Query  13   VYDQDGNPLRIGERYIIKNPLLG-AGAVYLDNIGNLQCPNAVLQHMSIPQFLGKGTPVVF 71
            V D D +PL+ G  Y +   + G +G +  ++ G   CP  V+Q    P    KG  +VF
Sbjct  28   VLDTDDDPLQNGGTYYMLPVMRGKSGGIEGNSTGKEICPLTVVQS---PNKHNKGIGLVF 84
Query  72   IRKSESDYGDVVRLMTAVYIKF-FVKTTKLC-VDETVWK-VNNEQL-VVTGGNVGNENDI 127
              KS   +   +     + IKF       LC V  T W  V  E L  VT       +  
Sbjct  85   --KSPL-HALFIAERYPLSIKFDSFAVIPLCGVMPTKWAIVEREGLQAVTLAARDTVDGW 141
Query  128  FKIKKTDLVIRGMKNVYKLLHCPSHLE---CKNIGSNFKN-GYPRLVTVNDEKDFIPF 181
            F I++   V R   + YKL+ CP   E   C++IG    N G  RLV   ++   + F
Sbjct  142  FNIER---VSREYNDYYKLVFCPQEAEDNKCEDIGIQIDNDGIRRLVLSKNKPLVVEF 196

Sequence Alignment: 8. Allergen Name: Gly m TI Sequence ID: AAB23464

 Score = 40.2 bits 146,  Expect = 5e-05
 Identities = 49/157 31%, Positives = 76/157 48%, Gaps = 26/157 16%
Query  13   VYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIPQFLGKGTPVVFI 72
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  +    L KG   +  
Sbjct  27   VLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRN---ELDKGIGTII- 82
Query  73   RKSESDYGDVVRLMTA---VYIKF-FVKTTKLCVD-ETVWKVNNEQLVVTGGNVGNENDI 127
                S Y   +R++     + +KF       LCV   T W V  +        +G   D 
Sbjct  83   ---SSPYR--IRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDA 137
Query  128  ----FKIKKTDLVIRGMKNVYKLLHCPSHLE---CKNIGSNFK--NGYPRLVTVNDEKDF 178
                F++++   V     N YKL+ CP + E   C +IG +    +G  RLV   ++   
Sbjct  138  MDGWFRLER---VSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLV 194
Query  179  IPF 181
            + F
Sbjct  195  VQF 197

Sequence Alignment: 9. Allergen Name: Gly m TI Sequence ID: CAA45777

 Score = 40.2 bits 146,  Expect = 5e-05
 Identities = 49/157 31%, Positives = 76/157 48%, Gaps = 26/157 16%
Query  13   VYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIPQFLGKGTPVVFI 72
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  +    L KG   +  
Sbjct  28   VLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRN---ELDKGIGTII- 83
Query  73   RKSESDYGDVVRLMTA---VYIKF-FVKTTKLCVD-ETVWKVNNEQLVVTGGNVGNENDI 127
                S Y   +R++     + +KF       LCV   T W V  +        +G   D 
Sbjct  84   ---SSPYR--IRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDA 138
Query  128  ----FKIKKTDLVIRGMKNVYKLLHCPSHLE---CKNIGSNFK--NGYPRLVTVNDEKDF 178
                F++++   V     N YKL+ CP + E   C +IG +    +G  RLV   ++   
Sbjct  139  MDGWFRLER---VSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLV 195
Query  179  IPF 181
            + F
Sbjct  196  VQF 198

Sequence Alignment: 10. Allergen Name: Gly m TI Sequence ID: P01071

 Score = 39.1 bits 141,  Expect = 9e-05
 Identities = 50/158 31%, Positives = 74/158 46%, Gaps = 24/158 15%
Query  13   VYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIPQFLGKGTPVVF- 71
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  +    L KG   +  
Sbjct  3    VLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRN---ELDKGIGTIIS 59
Query  72   --IRKSESDYGDVVRLMTAVYIKFFVKTTKLCVD-ETVWKVNNEQLVVTGGNVGNENDI- 127
               R      G+ +RL    +  F V    LCV   T W V  +        +G   D  
Sbjct  60   SPFRIRFIAEGNPLRLK---FDSFAV--IMLCVGIPTEWSVVEDLPEGPAVKIGENKDAV 114
Query  128  ---FKIKKTDLVIRGMKNVYKLLHCPSHLE---CKNIGSNFK--NGYPRLVTVNDEKDFI 179
               F+I++   V     N YKL+ C  + E   C +IG +    +G  RLV   ++   +
Sbjct  115  DGWFRIER---VSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVV 171
Query  180  PF 181
             F
Sbjct  172  QF 173

Sequence Alignment: 11. Allergen Name: Gly m TI Sequence ID: CAA45778

 Score = 38.8 bits 140,  Expect = 0.0001
 Identities = 50/158 31%, Positives = 74/158 46%, Gaps = 24/158 15%
Query  13   VYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIPQFLGKGTPVVF- 71
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  +    L KG   +  
Sbjct  28   VLDNEGNPLDSGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRN---ELDKGIGTIIS 84
Query  72   --IRKSESDYGDVVRLMTAVYIKFFVKTTKLCVD-ETVWKVNNEQLVVTGGNVGNENDI- 127
               R      G+ +RL    +  F V    LCV   T W V  +        +G   D  
Sbjct  85   SPFRIRFIAEGNPLRLK---FDSFAV--IMLCVGIPTEWSVVEDLPEGPAVKIGENKDAV 139
Query  128  ---FKIKKTDLVIRGMKNVYKLLHCPSHLE---CKNIGSNFK--NGYPRLVTVNDEKDFI 179
               F+I++   V     N YKL+ C  + E   C +IG +    +G  RLV   ++   +
Sbjct  140  DGWFRIER---VSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVV 196
Query  180  PF 181
             F
Sbjct  197  QF 198

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.