The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGNLWEVKSAKPL
TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPEYN
Sequence Info Allergen Name Length Opt Bits Score E Value
P14948 Lol p 3 97 641 199.7 1.2e-53
P93124 Dac g 3 96 551 172.5 1.8e-45
2JNZ_A Phl p 3.0101 108 541 169.4 1.8e-44
CAA90746 Tri a 3 118 466 146.6 1.4e-37
P14947 Lol p 2 97 407 128.9 2.4e-32
P43214 Phl p 2 122 376 119.3 2.3e-29
CAA10345 Dac g 2 122 376 119.3 2.3e-29
CAA10346 Cyn d 2 122 376 119.3 2.3e-29
CAA10348 Poa p 2 122 376 119.3 2.3e-29
CAA51775 Lol p 2 88 369 117.5 6e-29
AAF72991 Ory s 1 267 228 73.9 2.4e-15
AAF72983 Ory s 1 267 223 72.4 6.7e-15
A0A4D6G2J8 Uro m 1.0201 229 211 68.9 6.6e-14
O04701 Cyn d 1 246 209 68.2 1.1e-13
CAA10520 Poa p a 263 205 67.0 2.9e-13
Q40638 Ory s 1 263 204 66.7 3.5e-13
P43213 Phl p 1 263 201 65.8 6.7e-13
AAP80171 Cyn d 15 112 193 64.0 9.5e-13
AAA63279 Lol p 1.0101 263 197 64.5 1.5e-12
QCX36431 Zoy m 1.0101 272 197 64.5 1.6e-12
CAA10140 Hol l 1 263 195 63.9 2.3e-12
Q41260 Pha a 1 269 195 63.9 2.4e-12
ABC58726 Sor h 1.0101 239 194 63.7 2.5e-12
P14946 Lol p 1 263 194 63.6 2.9e-12
AAK96255 Cyn d 1.0201 244 193 63.4 3.2e-12
AAA63278 Lol p 1.0102 252 193 63.4 3.3e-12
AAL14079 Cyn d 1.0203 262 192 63.0 4.4e-12
A0A4D6FZ45 Uro m 1.0101 262 192 63.0 4.4e-12
AAL14077 Cyn d 1.0202 262 192 63.0 4.4e-12
AAF80379 Cyn d 1.0204 244 190 62.5 6e-12
CAA93121 Hol l 1.0102 248 189 62.2 7.5e-12
P43216 Hol l 1 265 189 62.1 8.3e-12
CAA81613 Phl p 1.0101 263 185 60.9 1.9e-11
CAB63699 Lol p 1.0103 263 185 60.9 1.9e-11
P58738 Zea m 1 269 183 60.3 3e-11
Q07154 Zea m 1 191 174 57.8 1.2e-10
AAL14078 Cyn d 1 262 171 56.7 3.6e-10
AAF72990 Ory s 1 269 166 55.1 1.1e-09
ACA23876 Pas n 1.0101 265 165 54.9 1.3e-09
A0A077B2S0 Sor h 2.0201 121 155 52.5 3.1e-09
AAF72984 Ory s 1 268 157 52.4 7e-09
Q41183 Dac g 2 36 136 47.7 2.5e-08
AAF72986 Ory s 1 275 151 50.6 2.6e-08
AAA50175 Gly m 2 277 147 49.4 6e-08
AAD10496 Tri a ps93 271 142 47.9 1.7e-07
AAB61710 Ory s 1 261 134 45.5 8.4e-07
AAF72988 Ory s 1 327 124 42.3 9.7e-06
CAB37496 Ara t expansin 265 122 41.8 1.1e-05
A0A077B7S9 Sor h 2.0101 119 116 40.7 1.1e-05
AAG13596 Ory s 1 275 120 41.2 1.7e-05
AAB23303 Dac g 2 26 86 32.8 0.00055
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 199.7 bits 641,  Expect = 1e-53
 Identities = 97/97 100%, Positives = 97/97 100%, Gaps = 0/97 0%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGNLWEVKSAKPL 60
            TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGNLWEVKSAKPL
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGNLWEVKSAKPL 60
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPEYN 97
            TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPEYN
Sbjct  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPEYN 97

Sequence Alignment: 2. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 172.5 bits 551,  Expect = 2e-45
 Identities = 80/94 85%, Positives = 87/94 92%, Gaps = 0/94 0%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGNLWEVKSAKPLT 61
            KV + VEKGSD K LVL+IKYTRPGDTLAEVELRQHGSEEWEP+TKKGNLWEVKS+KPLT
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLT 61
Query  62   GPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95
            GP NFRF+SKGGM+NVFDEVIPTAF +G TYTPE
Sbjct  62   GPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPE 95

Sequence Alignment: 3. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 169.4 bits 541,  Expect = 2e-44
 Identities = 76/94 80%, Positives = 88/94 93%, Gaps = 0/94 0%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGNLWEVKSAKPLT 61
            +V +TV+KGSD K LVL+IKYTRPGD+LAEVELRQHGSEEWEP+TKKGN+WEVKS+KPL 
Sbjct  14   QVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPLV 73
Query  62   GPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95
            GP NFRF+SKGGM+NVFDEVIPTAF++GKTY PE
Sbjct  74   GPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPE 107

Sequence Alignment: 4. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 146.6 bits 466,  Expect = 1e-37
 Identities = 67/95 70%, Positives = 77/95 81%, Gaps = 0/95 0%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGNLWEVKSAKPLT 61
            KV LTV+KGSD K L L I YTRP D+L+EVELRQ+GSEEW+P+TKKG++WEV  +KPL 
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKKGDVWEVSCSKPLV 83
Query  62   GPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPEY 96
            GP NFRFLSK GMK VFDEV  T F +GKTY PEY
Sbjct  84   GPFNFRFLSKNGMKKVFDEVFSTDFKIGKTYEPEY 118

Sequence Alignment: 5. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 128.9 bits 407,  Expect = 2e-32
 Identities = 57/93 61%, Positives = 74/93 79%, Gaps = 1/93 1%
Query  3    VDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGN-LWEVKSAKPLT 61
            V++TVEKGSD K L L+IKY + GD++AEVEL++HGS EW  + K G+ +WE+KS KPL 
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLK 63
Query  62   GPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95
            GP NFRF+S+ GM+NVFD+V+P  F VG TY PE
Sbjct  64   GPFNFRFVSEKGMRNVFDDVVPADFKVGTTYKPE 97

Sequence Alignment: 6. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 119.3 bits 376,  Expect = 2e-29
 Identities = 56/92 60%, Positives = 72/92 78%, Gaps = 3/92 3%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTK-KGNLWEVKSAKPL 60
            KV +TVEKGS+ K L + +KY   GDT+AEVELR+HGS+EW  MTK +G +W   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95
             GP NFRFL++ GMKNVFD+V+P  +T+G TY PE
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPE 121

Sequence Alignment: 7. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 119.3 bits 376,  Expect = 2e-29
 Identities = 56/92 60%, Positives = 72/92 78%, Gaps = 3/92 3%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTK-KGNLWEVKSAKPL 60
            KV +TVEKGS+ K L + +KY   GDT+AEVELR+HGS+EW  MTK +G +W   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95
             GP NFRFL++ GMKNVFD+V+P  +T+G TY PE
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPE 121

Sequence Alignment: 8. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 119.3 bits 376,  Expect = 2e-29
 Identities = 56/92 60%, Positives = 72/92 78%, Gaps = 3/92 3%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTK-KGNLWEVKSAKPL 60
            KV +TVEKGS+ K L + +KY   GDT+AEVELR+HGS+EW  MTK +G +W   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95
             GP NFRFL++ GMKNVFD+V+P  +T+G TY PE
Sbjct  87   KGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPE 121

Sequence Alignment: 9. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 119.3 bits 376,  Expect = 2e-29
 Identities = 56/92 60%, Positives = 72/92 78%, Gaps = 3/92 3%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTK-KGNLWEVKSAKPL 60
            KV +TVEKGS+ K L + +KY   GDT+AEVELR+HGS+EW  MTK +G +W   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95
             GP NFRFL++ GMKNVFD+V+P  +T+G TY PE
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPE 121

Sequence Alignment: 10. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 117.5 bits 369,  Expect = 6e-29
 Identities = 52/86 60%, Positives = 68/86 79%, Gaps = 1/86 1%
Query  4    DLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGN-LWEVKSAKPLTG 62
            ++TVEKGSD K L L+IKY++ GD +AEVEL++HGS EW  + K G+ +WE+KS KPL G
Sbjct  1    EFTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 60
Query  63   PMNFRFLSKGGMKNVFDEVIPTAFTVG 89
            P NFRF+S+ GM NVFD+V+P  F VG
Sbjct  61   PFNFRFVSEKGMWNVFDDVVPADFKVG 87

Sequence Alignment: 11. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 73.9 bits 228,  Expect = 2e-15
 Identities = 34/95 35%, Positives = 56/95 58%, Gaps = 1/95 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TKV + VEKGS+   + + +KY      + +VEL++ GSEEW+P+ +  G +W + + KP
Sbjct  168  TKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKP 227
Query  60   LTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95
            L GP ++R  ++   K V ++VIP  +     Y  E
Sbjct  228  LKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 72.4 bits 223,  Expect = 7e-15
 Identities = 31/92 33%, Positives = 53/92 57%, Gaps = 1/92 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + +EK S+   L L +KY      + EVE+++ GSEEW+ + +  G +W + + KP
Sbjct  168  TKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKP 227
Query  60   LTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
            L GP + R  ++GG K + ++ IP  +     Y
Sbjct  228  LKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVY 260

Sequence Alignment: 13. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 68.9 bits 211,  Expect = 7e-14
 Identities = 33/93 35%, Positives = 52/93 55%, Gaps = 1/93 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + VEKG +   + L IKY      +  V++++ GSEE+ P+    G +W + S KP
Sbjct  131  TKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAIWRIDSPKP 190
Query  60   LTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
            + GP+  R+ S+GG   V D+ IP  +     YT
Sbjct  191  IKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYT 224

Sequence Alignment: 14. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 68.2 bits 209,  Expect = 1e-13
 Identities = 33/93 35%, Positives = 51/93 54%, Gaps = 1/93 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + +EKGS+   L L +KY      +  V+++   S+E+ PM    G +W +   KP
Sbjct  146  TKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKP 205
Query  60   LTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
            L GP + R+ S+GG   V D+VIP  +     YT
Sbjct  206  LKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYT 239

Sequence Alignment: 15. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 67.0 bits 205,  Expect = 3e-13
 Identities = 34/91 37%, Positives = 55/91 60%, Gaps = 3/91 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKY-TRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TKV + VEKGS+   L L +KY T  GD +A V++++ G ++W  + +  G++W V +  
Sbjct  168  TKVTFHVEKGSNPNYLALLVKYVTGDGDVVA-VDIKEKGKDKWIELKESWGSIWRVDTPD 226
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
             LTGP   R+ ++GG K   ++VIP  +     Y
Sbjct  227  KLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 260

Sequence Alignment: 16. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 66.7 bits 204,  Expect = 4e-13
 Identities = 28/83 33%, Positives = 50/83 60%, Gaps = 1/83 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + +EK S+   L L +KY      + EVE+++ GSEEW+ + +  G +W + + KP
Sbjct  165  TKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKP 224
Query  60   LTGPMNFRFLSKGGMKNVFDEVIP 83
            L GP + R  ++G  ++  ++ IP
Sbjct  225  LKGPFSVRVTTEGARRSSAEDAIP 248

Sequence Alignment: 17. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 65.8 bits 201,  Expect = 7e-13
 Identities = 32/91 35%, Positives = 54/91 59%, Gaps = 3/91 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TKV + VEKGS+   L L +KY    GD +A V++++ G ++W  + +  G +W + +  
Sbjct  168  TKVTFHVEKGSNPNYLALLVKYVNGDGDVVA-VDIKEKGKDKWIELKESWGAIWRIDTPD 226
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
             LTGP   R+ ++GG K   ++VIP  +    +Y
Sbjct  227  KLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSY 260

Sequence Alignment: 18. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 64.0 bits 193,  Expect = 9e-13
 Identities = 32/80 40%, Positives = 52/80 65%, Gaps = 6/80 7%
Query  7    VEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGNLWEVKSAKPLTGPMNF 66
            VE+ S    + L+IK +     + +V++R+HG++  +PMTK G+ W +   KPL GP+N 
Sbjct  26   VEESSPK--FALSIKDS--AKEITQVDVREHGADNMDPMTKSGDSWTID--KPLKGPLNI 79
Query  67   RFLSKGGMKNVFDEVIPTAFTVGKTY 92
            R+ ++GG   V D+VIP  +  G  Y
Sbjct  80   RLRAEGGGSRVQDDVIPENWKAGTDY 105

Sequence Alignment: 19. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 64.5 bits 197,  Expect = 2e-12
 Identities = 30/92 32%, Positives = 55/92 59%, Gaps = 3/92 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TK  + VEK S+   L + +KY    GD +A V++++ G ++W  + +  G +W + +  
Sbjct  168  TKPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWTELKESWGAVWRIDTPD 226
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
             LTGP   R+ ++GG K+ F++VIP  +    +Y+
Sbjct  227  KLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYS 261

Sequence Alignment: 20. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 64.5 bits 197,  Expect = 2e-12
 Identities = 32/93 34%, Positives = 50/93 53%, Gaps = 1/93 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + VEKG +   L L ++Y      +  V+++  GS+E+ PM    G +W +   KP
Sbjct  174  TKITFHVEKGCNDNYLALLVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKP 233
Query  60   LTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
            L GP   R+ S+ G K V ++VIP  +     YT
Sbjct  234  LKGPFTVRLTSESGAKLVQEDVIPADWKPNTAYT 267

Sequence Alignment: 21. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 63.9 bits 195,  Expect = 2e-12
 Identities = 33/91 36%, Positives = 53/91 58%, Gaps = 3/91 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TKV + VEKGS+   L L +KY    GD +A V++++ G ++W  + +  G +W V +  
Sbjct  168  TKVTFHVEKGSNPNYLALLVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPD 226
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
             LTGP   R+ ++GG K   ++VIP  +     Y
Sbjct  227  KLTGPFTVRYTTEGGTKVEAEDVIPEGWKADTAY 260

Sequence Alignment: 22. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 63.9 bits 195,  Expect = 2e-12
 Identities = 31/82 37%, Positives = 51/82 62%, Gaps = 3/82 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TK  + VEKGS+   L L +KY    GD +A V++++ G ++W  + +  G +W + +  
Sbjct  174  TKPTFHVEKGSNPNYLALLVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAIWRIDTPD 232
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIP 83
             LTGP   R+ ++GG K  F++VIP
Sbjct  233  KLTGPFTVRYTTEGGTKAEFEDVIP 257

Sequence Alignment: 23. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 63.7 bits 194,  Expect = 2e-12
 Identities = 29/92 31%, Positives = 50/92 54%, Gaps = 1/92 1%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKPL 60
            KV + VEKGS+   L L +KY      +  V++++ G + ++P+    G +W   S  P+
Sbjct  145  KVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEKGGDAYQPLKHSWGAIWRKDSPDPI 204
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
              P+  +  ++GG K  +D+VIP  +    TYT
Sbjct  205  KFPVTVQITTEGGTKTAYDDVIPEGWKADTTYT 237

Sequence Alignment: 24. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 63.6 bits 194,  Expect = 3e-12
 Identities = 30/92 32%, Positives = 55/92 59%, Gaps = 3/92 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TK  + VEK S+   L + +KY    GD +A V++++ G ++W  + +  G +W + +  
Sbjct  168  TKPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPD 226
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
             LTGP   R+ ++GG K+ F++VIP  +    +Y+
Sbjct  227  KLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYS 261

Sequence Alignment: 25. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 63.4 bits 193,  Expect = 3e-12
 Identities = 31/83 37%, Positives = 46/83 55%, Gaps = 1/83 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + VEKGS    L L +KY      +  V+++  GS+E+ PM +  G +W +   KP
Sbjct  146  TKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRIDPPKP 205
Query  60   LTGPMNFRFLSKGGMKNVFDEVIP 83
            L GP   R+ S+ G     D+VIP
Sbjct  206  LKGPFTIRLTSESGGHVEQDDVIP 229

Sequence Alignment: 26. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 63.4 bits 193,  Expect = 3e-12
 Identities = 30/92 32%, Positives = 55/92 59%, Gaps = 3/92 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TK  + VEKGS+   L + +KY    GD +A V++++ G ++W  + +  G +W + +  
Sbjct  157  TKPTFHVEKGSNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPD 215
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
             LTGP   R+ ++GG K+  ++VIP  +    +Y+
Sbjct  216  KLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS 250

Sequence Alignment: 27. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 63.0 bits 192,  Expect = 4e-12
 Identities = 30/83 36%, Positives = 47/83 56%, Gaps = 1/83 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + VEKGS+   L L +KY      +  V+++  GS+E+ PM +  G +W +   KP
Sbjct  164  TKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKP 223
Query  60   LTGPMNFRFLSKGGMKNVFDEVIP 83
            L GP   R+ S+ G     ++VIP
Sbjct  224  LKGPFTIRLTSESGGHVEQEDVIP 247

Sequence Alignment: 28. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 63.0 bits 192,  Expect = 4e-12
 Identities = 30/83 36%, Positives = 47/83 56%, Gaps = 1/83 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + VEKGS+   L L +KY      +  V+++  GS+E+ PM +  G +W +   KP
Sbjct  164  TKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKP 223
Query  60   LTGPMNFRFLSKGGMKNVFDEVIP 83
            L GP   R+ S+ G     ++VIP
Sbjct  224  LKGPFTIRLTSESGGHVEQEDVIP 247

Sequence Alignment: 29. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 63.0 bits 192,  Expect = 4e-12
 Identities = 30/83 36%, Positives = 47/83 56%, Gaps = 1/83 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + VEKGS+   L L +KY      +  V+++  GS+E+ PM +  G +W +   KP
Sbjct  164  TKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKP 223
Query  60   LTGPMNFRFLSKGGMKNVFDEVIP 83
            L GP   R+ S+ G     ++VIP
Sbjct  224  LKGPFTIRLTSESGGHVEQEDVIP 247

Sequence Alignment: 30. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 62.5 bits 190,  Expect = 6e-12
 Identities = 31/83 37%, Positives = 46/83 55%, Gaps = 1/83 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + VEKGS    L L +KY      +  V+++  GS+E+ PM +  G +W +   KP
Sbjct  146  TKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKP 205
Query  60   LTGPMNFRFLSKGGMKNVFDEVIP 83
            L GP   R+ S+ G     D+VIP
Sbjct  206  LKGPFTIRLTSESGGHVEQDDVIP 229

Sequence Alignment: 31. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 62.2 bits 189,  Expect = 8e-12
 Identities = 32/91 35%, Positives = 52/91 57%, Gaps = 3/91 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TK  + VEKGS+   L L +KY    GD +A V++++ G ++W  + +  G +W V +  
Sbjct  153  TKPTFHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPD 211
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
             LTGP   R+ ++GG K   ++VIP  +     Y
Sbjct  212  KLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245

Sequence Alignment: 32. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 62.1 bits 189,  Expect = 8e-12
 Identities = 32/91 35%, Positives = 52/91 57%, Gaps = 3/91 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TK  + VEKGS+   L L +KY    GD +A V++++ G ++W  + +  G +W V +  
Sbjct  170  TKPTFHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPD 228
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
             LTGP   R+ ++GG K   ++VIP  +     Y
Sbjct  229  KLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 262

Sequence Alignment: 33. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 60.9 bits 185,  Expect = 2e-11
 Identities = 30/91 32%, Positives = 52/91 57%, Gaps = 3/91 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TKV + VEKGS+   L L +K+    GD +A V++++ G ++W  + +  G +W + + +
Sbjct  168  TKVTFHVEKGSNPNYLALLVKFVAGDGDVVA-VDIKEKGKDKWIALKESWGAIWRIDTPE 226
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
             L GP   R+ ++GG K    +VIP  +     Y
Sbjct  227  VLKGPFTVRYTTEGGTKGEAKDVIPEGWKADTAY 260

Sequence Alignment: 34. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 60.9 bits 185,  Expect = 2e-11
 Identities = 29/92 31%, Positives = 54/92 58%, Gaps = 3/92 3%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
            TK  + VEK S+   L + +KY    GD +A V++++ G ++W  + +  G +W + +  
Sbjct  168  TKPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPD 226
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
             LTGP   R+ ++GG K+  ++VIP  +    +Y+
Sbjct  227  KLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS 261

Sequence Alignment: 35. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 60.3 bits 183,  Expect = 3e-11
 Identities = 29/92 31%, Positives = 49/92 53%, Gaps = 1/92 1%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKPL 60
            K+ + +EKG +   L + +KY      +  +E++   S EW+PM    G +W + +AK L
Sbjct  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
             GP + R+ S+ G K +  +VIP  +     YT
Sbjct  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVYT 263

Sequence Alignment: 36. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 57.8 bits 174,  Expect = 1e-10
 Identities = 26/92 28%, Positives = 49/92 53%, Gaps = 1/92 1%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKPL 60
            K+ + +EKG +   + + +K+      +  +E++   S EW+PM    G +W + +AK L
Sbjct  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
             GP + R+ S+ G K +  ++IP  +     YT
Sbjct  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVYT 185

Sequence Alignment: 37. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 56.7 bits 171,  Expect = 4e-10
 Identities = 29/83 34%, Positives = 44/83 53%, Gaps = 1/83 1%
Query  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            TK+ + VEKGS    L L +KY      +  V+++  GS+ + PM    G +W +   KP
Sbjct  164  TKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKP 223
Query  60   LTGPMNFRFLSKGGMKNVFDEVIP 83
            L GP   R+ S+ G     ++VIP
Sbjct  224  LKGPFTIRLTSESGGHVEQEDVIP 247

Sequence Alignment: 38. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 55.1 bits 166,  Expect = 1e-09
 Identities = 26/91 28%, Positives = 46/91 50%, Gaps = 1/91 1%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKPL 60
            KV + VEKGS+   L + +K+      + +++L++ G   W PM    G +W + +A PL
Sbjct  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPL 230
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
              P + R  ++ G   +  +VIP  +     Y
Sbjct  231  KAPFSIRVTTESGKSLIAKDVIPVNWMPDAIY 262

Sequence Alignment: 39. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 54.9 bits 165,  Expect = 1e-09
 Identities = 27/90 30%, Positives = 48/90 53%, Gaps = 2/90 2%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKPL 60
            K+ + VEKGS+   L + +K+      +  +EL++  S+ W+PM    G +W + + K L
Sbjct  169  KIVFHVEKGSNPNYLAMLVKFVADDGDIVLMELKEKSSD-WKPMKLSWGAIWRMDTPKAL 227
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
              P + R+ S+ G K +  +VIP  +     Y
Sbjct  228  VPPFSIRLTSESGKKVIAQDVIPVNWKPDTVY 259

Sequence Alignment: 40. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 52.5 bits 155,  Expect = 3e-09
 Identities = 28/85 32%, Positives = 47/85 55%, Gaps = 5/85 5%
Query  5    LTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGN--LWEVKSAKPLTG 62
            LT+E G D+ +  L++        ++EV ++  G+ ++    K+     + + S +P+ G
Sbjct  29   LTIEVGKDSTSTKLSLI---TNVAISEVSVKPKGATDFTDDLKESEPKTFTLDSKEPIEG 85
Query  63   PMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
            P+ FRFL+KGG   V D  IP  F  G  Y
Sbjct  86   PIAFRFLAKGGGYRVVDNAIPADFKAGSVY 115

Sequence Alignment: 41. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 52.4 bits 157,  Expect = 7e-09
 Identities = 26/91 28%, Positives = 49/91 53%, Gaps = 1/91 1%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKPL 60
            KV + VE+GS+   + + ++Y      + +V+L +  S+ W PM +  G++W + S   L
Sbjct  169  KVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRL 228
Query  61   TGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
            T P ++R  ++ G + V  +VIP  +     Y
Sbjct  229  TAPFSLRITNESGKQLVASQVIPANWAPMAVY 260

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: Q41183

 Score = 47.7 bits 136,  Expect = 3e-08
 Identities = 21/33 63%, Positives = 27/33 81%, Gaps = 0/33 0%
Query  3    VDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELR 35
            V +TVEKGSD K L L+IKY + GD++AEVEL+
Sbjct  4    VTFTVEKGSDEKNLALSIKYNKEGDSMAEVELK 36

Sequence Alignment: 43. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 50.6 bits 151,  Expect = 3e-08
 Identities = 30/95 31%, Positives = 47/95 49%, Gaps = 4/95 4%
Query  3    VDLTVEKGSDAKTLVLNIKYTRPGDTLAEVE-LRQHGSEEWEPMTKK-GNLWEVKS--AK 58
            V + V+ GS+   L + ++Y      LA V  ++  G   W+ M +  G  W + S   K
Sbjct  174  VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGK 233
Query  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPEYN 97
            PL+ P + R+ S  G   V + VIP+ +  G TY    N
Sbjct  234  PLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVN 272

Sequence Alignment: 44. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 49.4 bits 147,  Expect = 6e-08
 Identities = 26/90 28%, Positives = 49/90 54%, Gaps = 3/90 3%
Query  3    VDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQH-GSEEWEPMTKK-GNLWEVKSAKPL 60
            + + V+ GS+ + +   ++Y      LA+VEL++   S  W+ M +  G +W+     PL
Sbjct  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
Query  61   TGPMNFRFLS-KGGMKNVFDEVIPTAFTVGKTY 92
              P + ++ + + G   V + VIP  +T G+TY
Sbjct  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269

Sequence Alignment: 45. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 47.9 bits 142,  Expect = 2e-07
 Identities = 26/91 28%, Positives = 47/91 51%, Gaps = 5/91 5%
Query  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQ--HGSEE--WEPMTKK-GNLWEVKS 56
            KV + V++GS+   L + ++Y     T+  +EL Q  +G     W+ M +  G++W + +
Sbjct  169  KVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMDT 228
Query  57   AKPLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
             +P+ GP + R  S  G   V +  IP  +     Y
Sbjct  229  NRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAY 264

Sequence Alignment: 46. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 45.5 bits 134,  Expect = 8e-07
 Identities = 22/90 24%, Positives = 48/90 53%, Gaps = 6/90 6%
Query  3    VDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQ-----HGSEEWEPMTKK-GNLWEVKS 56
            V++ VE GS+   L + +++     T+ ++++ +       +  W PM +  G++W + +
Sbjct  159  VNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDA 218
Query  57   AKPLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
               L GP ++R +S+ G   +  +VIP  +     Y
Sbjct  219  NHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254

Sequence Alignment: 47. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 42.3 bits 124,  Expect = 1e-05
 Identities = 25/91 27%, Positives = 50/91 54%, Gaps = 11/91 12%
Query  3    VDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQH--------GSEE--WEPMTKK-GNL 51
            V + VE+GS+   + + ++Y      + +V+L +         G+    W PM +  G++
Sbjct  220  VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSI 279
Query  52   WEVKSAKPLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYT 93
            W + +  PL GP ++R  ++ G   + D+VIP  +     Y+
Sbjct  280  WRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYS 321

Sequence Alignment: 48. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 41.8 bits 122,  Expect = 1e-05
 Identities = 28/89 31%, Positives = 47/89 52%, Gaps = 7/89 7%
Query  2    KVDLTVEKGS-DAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
            K+++ VE+ S +   L + + Y      +  + + Q GS  W  MT+  G +W V    P
Sbjct  149  KMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVW-VTDKVP 207
Query  60   LTGPMNFRFLSKGGM--KNVFDE-VIPTAFTVGKTY 92
              G + FRF+   G   K V+ + V+P  +  GK+Y
Sbjct  208  -NGALQFRFVVTAGYDGKMVWSQRVLPANWEAGKSY 242

Sequence Alignment: 49. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 40.7 bits 116,  Expect = 1e-05
 Identities = 26/82 31%, Positives = 43/82 52%, Gaps = 7/82 8%
Query  6    TVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKG--NLWEVKSAKPLTGP 63
            T+ K S +  LVL        D ++EV ++  G+ ++    K+     +  +S +P+ GP
Sbjct  30   TIGKDSTSTRLVL----VASAD-VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIKGP 84
Query  64   MNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92
            ++ RF  KG      D+VIP  F  G  Y
Sbjct  85   LSVRFAVKGQGYRTTDDVIPADFKPGSVY 113

Sequence Alignment: 50. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 41.2 bits 120,  Expect = 2e-05
 Identities = 27/83 32%, Positives = 42/83 50%, Gaps = 7/83 8%
Query  8    EKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKPLTGPMNF 66
            EK    + L +   Y      +  V++   GS  W+ MT+  G  W   +A+   GP+ F
Sbjct  165  EKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQF 222
Query  67   RFLSKGGM--KNVF--DEVIPTAFTVGKTY 92
            R +  GG   K V+   EV+P  +T G+ Y
Sbjct  223  RVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252

Sequence Alignment: 51. Allergen Name: Dac g 2 Sequence ID: AAB23303

 Score = 32.8 bits 86,  Expect = 0.0006
 Identities = 14/22 63%, Positives = 17/22 77%, Gaps = 0/22 0%
Query  3    VDLTVEKGSDAKTLVLNIKYTR 24
            V +TVEKGSD K L L+IKY +
Sbjct  4    VTFTVEKGSDEKNLALSIKYNK 25

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.