The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

TMEHYLKTYLSWLTEEQKEKLKEMKEAGKTKAEIQHEVMHYYDQLHGEEKQQATEKLKVG
CKMLLKGIIGEEKVVELRNMKEAGADIQELQQKVEKMLSEVTDEKQKEKVHEYGPACKKI
FGATTLQHHRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKTKKELEAKILHYYDE
LEGDAKKEATEHLKGGCGEILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDE
EKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAK
KELEAKILHYYDELEGDAKKEATEHLKGGCAEILKHVVGEEKAAELKNLKDSGASKEELK
AKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQK
DELLKMKKDGKTKKDLQAKILHYYDELEGDAKKEATEHLKDGCREILKHVVGEEKEAELK
KLKDSGASKEEVKAKVEEALHAVTDEEKKQYIADFGPACKKIFGAAHTSRRRRHHFTLES
SLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREI
LKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVH
TSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKK
EATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIA
DFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKI
LHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEAL
HAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMK
KDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGA
SKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKW
LSQEQKDELLKMKKD
Sequence Info Allergen Name Length Opt Bits Score E Value
AF051702 Asc s 1.0101 1095 7124 1629.9 0
AAC47403 Dic v a 1557 1342 311.9 3.7e-85
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Asc s 1.0101 Sequence ID: AF051702

 Score = 1629.9 bits 7124,  Expect = 0
 Identities = 1095/1095 100%, Positives = 1095/1095 100%, Gaps = 0/1095 0%
Query  1    TMEHYLKTYLSWLTEEQKEKLKEMKEAGKTKAEIQHEVMHYYDQLHGEEKQQATEKLKVG 60
            TMEHYLKTYLSWLTEEQKEKLKEMKEAGKTKAEIQHEVMHYYDQLHGEEKQQATEKLKVG
Sbjct  1    TMEHYLKTYLSWLTEEQKEKLKEMKEAGKTKAEIQHEVMHYYDQLHGEEKQQATEKLKVG 60
Query  61   CKMLLKGIIGEEKVVELRNMKEAGADIQELQQKVEKMLSEVTDEKQKEKVHEYGPACKKI 120
            CKMLLKGIIGEEKVVELRNMKEAGADIQELQQKVEKMLSEVTDEKQKEKVHEYGPACKKI
Sbjct  61   CKMLLKGIIGEEKVVELRNMKEAGADIQELQQKVEKMLSEVTDEKQKEKVHEYGPACKKI 120
Query  121  FGATTLQHHRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKTKKELEAKILHYYDE 180
            FGATTLQHHRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKTKKELEAKILHYYDE
Sbjct  121  FGATTLQHHRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKTKKELEAKILHYYDE 180
Query  181  LEGDAKKEATEHLKGGCGEILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDE 240
            LEGDAKKEATEHLKGGCGEILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDE
Sbjct  181  LEGDAKKEATEHLKGGCGEILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDE 240
Query  241  EKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAK 300
            EKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAK
Sbjct  241  EKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAK 300
Query  301  KELEAKILHYYDELEGDAKKEATEHLKGGCAEILKHVVGEEKAAELKNLKDSGASKEELK 360
            KELEAKILHYYDELEGDAKKEATEHLKGGCAEILKHVVGEEKAAELKNLKDSGASKEELK
Sbjct  301  KELEAKILHYYDELEGDAKKEATEHLKGGCAEILKHVVGEEKAAELKNLKDSGASKEELK 360
Query  361  AKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQK 420
            AKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQK
Sbjct  361  AKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQK 420
Query  421  DELLKMKKDGKTKKDLQAKILHYYDELEGDAKKEATEHLKDGCREILKHVVGEEKEAELK 480
            DELLKMKKDGKTKKDLQAKILHYYDELEGDAKKEATEHLKDGCREILKHVVGEEKEAELK
Sbjct  421  DELLKMKKDGKTKKDLQAKILHYYDELEGDAKKEATEHLKDGCREILKHVVGEEKEAELK 480
Query  481  KLKDSGASKEEVKAKVEEALHAVTDEEKKQYIADFGPACKKIFGAAHTSRRRRHHFTLES 540
            KLKDSGASKEEVKAKVEEALHAVTDEEKKQYIADFGPACKKIFGAAHTSRRRRHHFTLES
Sbjct  481  KLKDSGASKEEVKAKVEEALHAVTDEEKKQYIADFGPACKKIFGAAHTSRRRRHHFTLES 540
Query  541  SLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREI 600
            SLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREI
Sbjct  541  SLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREI 600
Query  601  LKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVH 660
            LKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVH
Sbjct  601  LKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVH 660
Query  661  TSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKK 720
            TSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKK
Sbjct  661  TSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKK 720
Query  721  EATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIA 780
            EATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIA
Sbjct  721  EATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIA 780
Query  781  DFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKI 840
            DFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKI
Sbjct  781  DFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKI 840
Query  841  LHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEAL 900
            LHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEAL
Sbjct  841  LHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEAL 900
Query  901  HAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMK 960
            HAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMK
Sbjct  901  HAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMK 960
Query  961  KDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGA 1020
            KDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGA
Sbjct  961  KDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGA 1020
Query  1021 SKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKW 1080
            SKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKW
Sbjct  1021 SKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLESSLDTHLKW 1080
Query  1081 LSQEQKDELLKMKKD 1095
            LSQEQKDELLKMKKD
Sbjct  1081 LSQEQKDELLKMKKD 1095

Sequence Alignment: 2. Allergen Name: Dic v a Sequence ID: AAC47403

 Score = 311.9 bits 1342,  Expect = 4e-85
 Identities = 366/988 37%, Positives = 604/988 61%, Gaps = 94/988 9%
Query  1    TMEHYLKTYLSWLTEEQKEKLKEMKEAGKTKAEIQHEVMHYYDQLHGEEKQQATEKLKVG 60
            ++E  +  YLSW+T+E KEK+K + E    +     E++   +    E K +ATEKL+  
Sbjct  550  SLEEAMDAYLSWMTDEDKEKVKAIYETSN-RQTFYDEILKIMESSEDEVKAKATEKLEAA 608
Query  61   CKMLLKGIIGEEKVVELRNMKEAGADIQELQQKVEKMLSEVTDEKQKEKVHEYGPACKKI 120
            CK     I+GEE V  +R MK+ GA  +E+  +V++++  +TD  +KEK +     CKKI
Sbjct  609  CKHYGTNILGEENVDIIREMKKNGATFEEISNRVDELIEGITDSDRKEKAYRMSKLCKKI 668
Query  121  FGATTLQHHRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKTKKELEAKILHYYDE 180
            +       H ++ +++ +E+ L  +L WL   QK+EL  M  +   K+++  KI+ Y+D 
Sbjct  669  YSLG----HSKQLQQYDFENVLQKYLTWLDDSQKNELRTMSDN---KEKIYKKIIDYFDG 721
Query  181  LEGDAKKEATEHLKGGCGEILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDE 240
              G+ K++A E L+  C   +K +VGEEKA E+K LK+ G S EE+  KVE+ ++ ++DE
Sbjct  722  TIGEVKEKAVEELQLACNHYIKSIVGEEKAMEIKQLKEEGKSSEEIAKKVEDVINQISDE 781
Query  241  EKKQYIADFGPACKKIYGVHTSRRRRHH---FTLESSLDTHLKWLSQEQKDELLKMKKDG 297
              +    +    CK+I+G+   R RR +    +LE +++ +L WLS +QK  ++K   D 
Sbjct  782  SIRSRADEALLVCKRIFGI-VKRLRRDNSEIHSLEEAMERYLTWLSDDQKI-VIKSIYDV 839
Query  298  KAKKELEAKILHYYDELEGDAKKEATEHLKGGCAEILKHVVGEEKAAELKNLKDSGASKE 357
              +K L  KI+ ++D+  G+ K++A + LK  C   +K ++GEE    L+ +K++GAS E
Sbjct  840  NDRKVLYEKIMEFFDDAIGETKQKAAKELKDACKHYVKDLIGEENGNLLREMKENGASNE 899
Query  358  ELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHF--TLESSLDTHLKWL 415
             +  KVEE + A+TDE K+        +C+K+YGV    RR HH    L+ +L+ H+ WL
Sbjct  900  AIATKVEEMIEAITDETKRAQAMRASTSCRKVYGVVQRFRRDHHHEHNLDEALEKHFTWL 959
Query  416  SQEQKDELLKMKKDGKTKKDLQAKILHYYDELEGDAKKEATEHLKDGCREILKHVVGEEK 475
            ++EQK +L K   + + ++ L+ K+  +++   G                          
Sbjct  960  NEEQKSQL-KTIYESEDREALHKKVWEFFEAGAG-------------------------- 992
Query  476  EAELKKLKDSGASKEEVKAKVEEALHAVTDEEKKQYIADFGPACKKIFGAAHTSRRRRHH 535
                  L+ S ASK                               KI+G A   RR  HH
Sbjct  993  ------LRASNASK-------------------------------KIYGVAKRFRRDHHH 1015
Query  536  -FTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLK 594
               L+ +L+ +L WL++EQK ++  + + G  ++ L  K+L +++   G+ K++A   LK
Sbjct  1016 EHNLDEALEKYLTWLNEEQKSQMKTIYESGD-REALYKKVLEFFEAATGEVKEKAAVELK 1074
Query  595  GGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACK 654
              CR  +K  +G+EKA ++K +K+SG S EE+  KV+E +  +TD+EKK        ACK
Sbjct  1075 SACRHYIKDYIGDEKAEKIKEMKESGVSTEEISKKVDEFIAMITDDEKKAKALRASSACK 1134
Query  655  KIYGVHTSRRRRHHF--TLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYD 712
            KIYGV    RR HH    LE +L+ +L WL++EQK ++  + + G  ++ L  K+L +++
Sbjct  1135 KIYGVAKRFRRDHHHEHNLEEALEKYLTWLNEEQKSQMKTIYESGD-REALYKKVLEFFE 1193
Query  713  ELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTD 772
               G+ K++A   LK  CR  +K  +G+EKA ++K +K+SG S EE+  KV+E +  +TD
Sbjct  1194 AATGEVKEKAAVELKSACRHYIKDYIGDEKAEKIKEMKESGVSTEEISKKVDEFIAMITD 1253
Query  773  EEKKQYIADFGPACKKIYGVHTSRRRRHHF--TLESSLDTHLKWLSQEQKDELLKMKKDG 830
            +EKK        ACKKIYGV    RR HH    LE ++  +L W+S EQ+ ++ K+   G
Sbjct  1254 DEKKAKALRASNACKKIYGVAKRLRRDHHHEHNLEEAMGKYLSWMSDEQQAQVKKIYGTG 1313
Query  831  KAKKELEAKILHYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKE 890
              +     K++  ++ +  D K++AT +LK  CR  +K  +G++  A +K +K+SGA+ E
Sbjct  1314 D-RLATYNKVMELFESVPSDEKEKATSQLKAACRHYIKDFIGKDNLAVIKEMKESGATNE 1372
Query  891  ELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRRRHHFTLE--SSLDTHLKWL 948
             +  K++E +  + DE+KK        ACKKIYGV  SR+RR H+ ++   ++  +L WL
Sbjct  1373 AIGEKIDEFIAGLDDEQKKAQAQRAASACKKIYGVK-SRKRREHYEIDVDEAISKYLTWL 1431
Query  949  SQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREILKHVVGEEK 1008
            ++EQK E+ ++K+  + K+ +  KI+ +++   GD K++A E+LK  C+  +K  VGEEK
Sbjct  1432 NEEQKAEIKQLKEKDE-KQTIGKKIMEFFELTSGDDKEKAREQLKAACKHYVKMYVGEEK 1490
Query  1009 AAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRRR---R 1065
            AAELK LKDSG S EE+  KV E +  + DE  +         C++I+G+  +RR    +
Sbjct  1491 AAELKKLKDSGISLEEMSKKVTETIETIEDEAVRAKARRIHSYCQRIFGITKARRHLAMK 1550
Query  1066 HH 1067
            HH
Sbjct  1551 HH 1552
 Score = 103.3 bits 427,  Expect = 2e-22
 Identities = 129/496 26%, Positives = 255/496 51%, Gaps = 48/496 9%
Query  276  DTHLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCAEILK 335
            DTH  WL+  QK EL  +K       +L  K L +Y++L  + K    +     C   LK
Sbjct  36   DTH-SWLTDVQKAELETLKHQ---PIQLRDKTLEFYNQLPTNEKAIWDKFYTKYCVVWLK 91
Query  336  HVVGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTS 395
             V  +E+  +LK L +S  +KE L   +  ++    DE  ++ +  +   C +      S
Sbjct  92   EVASDEEIGKLKEL-ESEKNKEALLTSIY-SFKDRLDEVDQRKVELWKETCDEYVTKGLS 149
Query  396  RRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKTKKDLQAKILHYYDELEGDAKKEA 455
            R+RR       +++  + W++ EQK  +  MK  GK+  +++ +   Y+  L  D +   
Sbjct  150  RKRRDS---NKNFEEFIYWMTDEQKQSMNDMKTAGKSFNEIHKEGRKYFKALTIDKQSSL 206
Query  456  TEHLKDGCREILKHVVGEEKEAELKKLKDSGASKEEVKAKVEEALHAVTDEEKKQYIADF 515
             E++KD C++ + ++   ++  ++K L D     +E++  V+ A+ A  + E K++    
Sbjct  207  KEQFKDKCKKYFMQIANSDEVEKIKSLND-----DEIRHVVKNAV-ARLNGEDKEFAVKM 260
Query  516  GPACKKIFGAAHTSRRRRHHFTLESSLDTHLKWLSQEQKDELLKMKKDGKAKKELEAKIL 575
               C+ ++  A  +R+      ++  ++  L W++ EQK  + ++  DG+++ ++ AKI+
Sbjct  261  ETLCEDVL--AFKARKN----DIDDKINRRLSWMTDEQKQVVKQLYADGRSQADIRAKIF 314
Query  576  HYYDELEGDAKKEATEHLKGGCREILKHVVGEEKAAELKNLKDSGASKEELKAKVEEALH 635
             +   ++G A   A  +++  C + ++ V   E+ A L  L +     +  + KV E + 
Sbjct  315  EFLSSIDGPAGVAAKAQIQKECYKWMEEVATAEEIAALHELHE--IDHDGCRRKVREFIG 372
Query  636  AVTDEEKKQYIADFGPACKKIY----GVHTS--------------RRRRHHFTLESSLDT 677
             + ++ K +   D+ P C+KI+    G H S              RRRRH + +E  LD 
Sbjct  373  RLPEDRKLEVEKDL-PFCEKIWYRDHGDHNSHKHGAHHHHRHLAVRRRRHLYAIEKFLD- 430
Query  678  HLKWLSQEQKDELLKMKKDGKAKKELEAKILHYYDELEGDAKKEATEHLKGGCREILKHV 737
               WL  EQK EL K++  G    ++ A++  +Y  L  + K E    +K  C + +K V
Sbjct  431  ---WLKPEQKHELEKIENSGAHFDDVIAEVKKFYGLLPEEKKIELKAKFKSQCYDWVKEV 487
Query  738  VGEEKAAELKNLKDSGASKEELKAKVEEALHAVTDEEKKQYIADFGPACKKIYGVHTSRR 797
               E+  ++  + +S    + +K   E  L     E++K+ I      C  ++ V+ + +
Sbjct  488  ATSEEMNDIMKMHESKNHSDLMKRLTE--LENRLTEDQKHTIEHVREVCLGLWEVQNTNK 545
Query  798  RRHH 801
            +  +
Sbjct  546  QHKQ 549

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.