The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETGQD
GVYRLPVVGYHEDCEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPL
SFRAKTDAPGC
Sequence Info Allergen Name Length Opt Bits Score E Value
CAC41635 Pla l 1.0103 131 884 258.8 3.4e-71
P82242 Pla l 1 131 867 254.0 9.9e-70
X76396 Ole e 1.0103 145 291 89.5 3.5e-20
CAA73037 Ole e 1.0106 146 290 89.2 4.4e-20
X76395 Ole e 1.0102 145 285 87.8 1.2e-19
CAA73038 Ole e 1.0105 146 285 87.8 1.2e-19
P19963 Ole e 1 145 283 87.2 1.7e-19
CAA73036 Ole e 1.0107 146 283 87.2 1.7e-19
AAQ83588 Fra e 1.0201 146 283 87.2 1.7e-19
O82015 Lig v 1 145 281 86.6 2.6e-19
X76397 Ole e 1.0104 145 279 86.1 3.8e-19
CAA54819 Lig v 1.0102 145 277 85.5 5.7e-19
CAA33854 Lyc e LAT52 161 274 84.6 1.2e-18
AAQ08947 Fra e 1.0101 145 267 82.6 4.1e-18
A0A0K1SC24 Aca f 1 150 263 81.5 9.5e-18
AAV74343 Fra e 1.0102 145 262 81.2 1.1e-17
AKV72167 Pro j 1.0101 150 245 76.3 3.3e-16
ADK22842 Sal k 5.0101 151 239 74.6 1.1e-15
AAB32652 Ole e 1.0101 130 232 72.7 3.5e-15
A0A0K1SC10 Ama r 1.0101 168 228 71.4 1.1e-14
AAL07319 Che a 1 168 217 68.3 1e-13
A0A0K1SC44 Koc s 1.0101 167 200 63.4 2.9e-12
Q7M1X5 Lol p 11.0101 134 186 59.6 3.3e-11
AAN32987 Phl p 11.0101 143 163 53.0 3.5e-09
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 258.8 bits 884,  Expect = 3e-71
 Identities = 131/131 100%, Positives = 131/131 100%, Gaps = 0/131 0%
Query  1    TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETGQD 60
            TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETGQD
Sbjct  1    TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETGQD 60
Query  61   GVYRLPVVGYHEDCEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPL 120
            GVYRLPVVGYHEDCEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPL
Sbjct  61   GVYRLPVVGYHEDCEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPL 120
Query  121  SFRAKTDAPGC 131
            SFRAKTDAPGC
Sbjct  121  SFRAKTDAPGC 131

Sequence Alignment: 2. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 254.0 bits 867,  Expect = 1e-69
 Identities = 129/131 98%, Positives = 129/131 98%, Gaps = 0/131 0%
Query  1    TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETGQD 60
            TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGET QD
Sbjct  1    TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQD 60
Query  61   GVYRLPVVGYHEDCEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPL 120
            GVYRLPVVGYHEDCEIKLVKS RPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPL
Sbjct  61   GVYRLPVVGYHEDCEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPL 120
Query  121  SFRAKTDAPGC 131
            SFRAKTDAPGC
Sbjct  121  SFRAKTDAPGC 131

Sequence Alignment: 3. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 89.5 bits 291,  Expect = 4e-20
 Identities = 49/120 40%, Positives = 77/120 64%, Gaps = 8/120 6%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
            ++FH++G+VYC+ C +R +I ELSE + GA V+L CKD ++  + ++  G T  +G+Y +
Sbjct  9    SQFHIQGQVYCDTCRAR-FITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSM 67
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
             +   H+D  CEI L+ S R DC EIP   +G ++ S + +  NT +   TR + PL F 
Sbjct  68   LIERDHKDEFCEITLISSSRKDCDEIP--VEGWVKPS-LKFMLNT-VNGTTRTINPLGFF 123
Query  124  AKTDAPGC 131
             K   P C
Sbjct  124  KKEALPKC 131

Sequence Alignment: 4. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 89.2 bits 290,  Expect = 4e-20
 Identities = 53/119 44%, Positives = 77/119 64%, Gaps = 10/119 8%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
            ++FH++G+VYC+ C +  +I ELSE + GA V+L CKD ++  V ++  G T  +G+Y +
Sbjct  10   SQFHIQGQVYCDTCRA-GFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSM 68
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
             V   H++  CEI L+ SGR DC+EIP   +G  + S K  LS   T+   TR V PL F
Sbjct  69   LVERDHKNEFCEITLISSGRKDCNEIP--TEGWAKPSLKFILS---TVNGTTRTVNPLGF 123
Query  123  RAKTDAPGC 131
              K   P C
Sbjct  124  YKKEALPKC 132

Sequence Alignment: 5. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 87.8 bits 285,  Expect = 1e-19
 Identities = 51/119 42%, Positives = 78/119 65%, Gaps = 10/119 8%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
            ++FH++G+VYC+ C +  +I ELSE + GA ++L CKD ++  V ++  G T  +G+Y +
Sbjct  9    SQFHIQGQVYCDTCRA-GFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSM 67
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
             V   H++  CEI L+ SGR DC+EIP   +G ++ S K  L+   T+   TR V PL F
Sbjct  68   LVERDHKNEFCEITLISSGRKDCNEIP--TEGWVKPSLKFILN---TVNGTTRTVNPLGF 122
Query  123  RAKTDAPGC 131
              K   P C
Sbjct  123  FKKEALPKC 131

Sequence Alignment: 6. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 87.8 bits 285,  Expect = 1e-19
 Identities = 52/119 43%, Positives = 77/119 64%, Gaps = 10/119 8%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
            ++FH++G+VYC+ C +  +I ELSE + GA V+L CKD ++  V ++  G T  +G+Y +
Sbjct  10   SQFHIQGQVYCDTCRA-GFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSM 68
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
             V   H++  CEI L+ SGR DC+EIP   +G  + S K  L+   T+   TR V PL F
Sbjct  69   LVERDHKNEFCEITLISSGRKDCNEIP--TEGWAKPSLKFILN---TVNGTTRTVNPLRF 123
Query  123  RAKTDAPGC 131
              K   P C
Sbjct  124  YKKEALPKC 132

Sequence Alignment: 7. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 87.2 bits 283,  Expect = 2e-19
 Identities = 51/119 42%, Positives = 77/119 64%, Gaps = 10/119 8%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
            ++FH++G+VYC+ C +  +I ELSE + GA ++L CKD ++  V ++  G T  +G+Y +
Sbjct  9    SQFHIQGQVYCDTCRA-GFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSM 67
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
             V   H++  CEI L+ SGR DC+EIP   +G  + S K  L+   T+   TR V PL F
Sbjct  68   LVERDHKNEFCEITLISSGRKDCNEIP--TEGWAKPSLKFKLN---TVNGTTRTVNPLGF 122
Query  123  RAKTDAPGC 131
              K   P C
Sbjct  123  FKKEALPKC 131

Sequence Alignment: 8. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 87.2 bits 283,  Expect = 2e-19
 Identities = 51/119 42%, Positives = 77/119 64%, Gaps = 10/119 8%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
            ++FH++G+VYC+ C SR +I ELSE + GA V+L C++ ++  + ++  G T  +G+Y +
Sbjct  10   SQFHIQGQVYCDTCRSR-FITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLYSM 68
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
             V   H++  CEI L+ SGR DC EIP   +G  + S K  L+   T+   TR V PL F
Sbjct  69   LVERDHKNEFCEITLISSGRKDCDEIP--IEGWAKPSLKFILN---TVNGTTRTVNPLGF 123
Query  123  RAKTDAPGC 131
              K   P C
Sbjct  124  FKKEALPKC 132

Sequence Alignment: 9. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 87.2 bits 283,  Expect = 2e-19
 Identities = 50/119 42%, Positives = 79/119 66%, Gaps = 10/119 8%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
            ++FH++G+VYC+ C +R +I +LSE + GA V+L C+D ++  V ++  G T  +G+Y +
Sbjct  10   SQFHIQGQVYCDTCRAR-FITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSM 68
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
             V   H++  CEI L+ SGR DC+EIP   +G ++ S K  L+   T+   TR + PL F
Sbjct  69   FVERDHKNEFCEITLLSSGRKDCNEIP--IEGWVKPSLKFILN---TVNGTTRTINPLGF 123
Query  123  RAKTDAPGC 131
              K   P C
Sbjct  124  FKKEALPQC 132

Sequence Alignment: 10. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 86.6 bits 281,  Expect = 3e-19
 Identities = 49/120 40%, Positives = 78/120 65%, Gaps = 8/120 6%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
            ++F+++G+VYC+ C +R +I ELSE + GA V+L CKD ++ KV ++  G T  +G+Y +
Sbjct  9    SQFYIQGQVYCDTCRAR-FITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTKAEGLYNM 67
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
             +   H++  CEI L+ S R DC EIP   +G ++ S + +  NT +   TR + PL F 
Sbjct  68   LIERDHKNEFCEITLISSSRKDCDEIP--TEGWVKPS-LKFVLNT-VNGTTRTINPLGFL 123
Query  124  AKTDAPGC 131
             K   P C
Sbjct  124  KKEVLPKC 131

Sequence Alignment: 11. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 86.1 bits 279,  Expect = 4e-19
 Identities = 49/120 40%, Positives = 78/120 65%, Gaps = 8/120 6%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
            ++F+V+G+VYC+ C +R +I E+SE + GA V+L CKD ++ K+ ++  G T  +G+Y +
Sbjct  9    SQFYVQGQVYCDTCRTR-FITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSM 67
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
             +   H++  CEI L+ S R DC EIP   +G ++ S V +  NT +   TR + PL F 
Sbjct  68   LIERDHKNEFCEITLLSSSRKDCDEIP--TEGWVKPS-VKFILNT-VNGTTRTINPLGFF 123
Query  124  AKTDAPGC 131
             K   P C
Sbjct  124  KKEALPKC 131

Sequence Alignment: 12. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 85.5 bits 277,  Expect = 6e-19
 Identities = 48/120 40%, Positives = 78/120 65%, Gaps = 8/120 6%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
            ++F+++G+VYC+ C +R +I ELSE + GA V+L CKD ++ K+ ++  G T  +G+Y +
Sbjct  9    SQFYIQGQVYCDTCRAR-FITELSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSM 67
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
             +   H++  CEI L+ S R DC EIP   +G ++ S + +  NT +   TR + PL F 
Sbjct  68   LIERDHKNEFCEITLLSSSRKDCDEIP--IEGWVKPS-LKFMLNT-VNGTTRTINPLGFF 123
Query  124  AKTDAPGC 131
             K   P C
Sbjct  124  KKEALPKC 131

Sequence Alignment: 13. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 84.6 bits 274,  Expect = 1e-18
 Identities = 47/121 38%, Positives = 70/121 57%, Gaps = 8/121 6%
Query  6    PAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYR 64
            P  F VEG+VYC+ C  + +  +LSE + GA V+L C++ S +   +S+ G T +DG Y+
Sbjct  24   PEVFDVEGKVYCDTCRVQ-FETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYK 82
Query  65   LPVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSF 122
            L V G HE+  CE+ +VKS R DC E    +    + ++++ S N  I    R   PL F
Sbjct  83   LTVNGDHENDICEVTVVKSPREDCKE----SVSGYEKARIECSDNVGIHNAVRFANPLFF 138
Query  123  RAKTDAPGC 131
                   GC
Sbjct  139  MKAESVQGC 147

Sequence Alignment: 14. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 82.6 bits 267,  Expect = 4e-18
 Identities = 50/117 42%, Positives = 75/117 64%, Gaps = 10/117 8%
Query  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRLPV 67
            F+V+G+VYC+ C +  +I ELSE + GA V+L CKD ++ KV ++  G T  +G+Y + +
Sbjct  11   FYVQGQVYCDTCRA-GFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVI 69
Query  68   VGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSFRA 124
               H++  CEI L+ S R DC EIP   +G ++ S K  L+   T+   TR + PL F  
Sbjct  70   ERDHKNEFCEIVLLSSSRKDCDEIP--TEGWVKPSLKFILN---TVNGTTRTINPLGFFK 124
Query  125  KTDAPGC 131
            K   P C
Sbjct  125  KEVLPKC 131

Sequence Alignment: 15. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 81.5 bits 263,  Expect = 9e-18
 Identities = 49/123 39%, Positives = 66/123 53%, Gaps = 5/123 4%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYRL 65
            ++FHV+G VYC+ C    +I E S  M GA V+L+C++ +     +     T + G Y +
Sbjct  9    SQFHVQGLVYCDTCR-YPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSI 67
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
            PV G HED  CEI+LVKS    CSEIP       Q++KV L+ N       R    L F 
Sbjct  68   PVDGDHEDDICEIELVKSPDNQCSEIPHDVYAK-QSAKVSLTSNNGEASDVRSANALGFM 126
Query  124  AKTDAPGC 131
             K   P C
Sbjct  127  RKEPLPEC 134

Sequence Alignment: 16. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 81.2 bits 262,  Expect = 1e-17
 Identities = 49/117 41%, Positives = 75/117 64%, Gaps = 10/117 8%
Query  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRLPV 67
            F+V+G+VYC+ C +  +I ELSE + GA V+L CK+ ++ KV ++  G T  +G+Y + +
Sbjct  11   FYVQGQVYCDTCRA-GFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTRAEGLYSMVI 69
Query  68   VGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSFRA 124
               H++  CEI L+ S R DC EIP   +G ++ S K  L+   T+   TR + PL F  
Sbjct  70   ERDHKNEFCEIVLLSSSRKDCHEIP--TEGWVKPSLKFILN---TVNGTTRTINPLGFFK 124
Query  125  KTDAPGC 131
            K   P C
Sbjct  125  KEALPKC 131

Sequence Alignment: 17. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 76.3 bits 245,  Expect = 3e-16
 Identities = 45/123 36%, Positives = 66/123 53%, Gaps = 5/123 4%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYRL 65
            ++FH++G VYC+ C  + ++  +S  M GA V+L+C++ +     +     T + G Y +
Sbjct  9    SQFHIQGLVYCDTCRIQ-FMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSI 67
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
            PV G  ED  CEI+LVKS   DCSEIP       Q++KV L+ N       R    L F 
Sbjct  68   PVNGDFEDDICEIELVKSPNSDCSEIPHDVYAK-QSAKVSLTSNNGEASDIRSANALGFM 126
Query  124  AKTDAPGC 131
             K     C
Sbjct  127  RKEPLKEC 134

Sequence Alignment: 18. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 74.6 bits 239,  Expect = 1e-15
 Identities = 45/121 37%, Positives = 63/121 52%, Gaps = 5/121 4%
Query  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYRLPV 67
            +HV+G VYC+ C  + +I  +S  M GA V L C++ +     +     T + G+Y + V
Sbjct  9    YHVKGMVYCDTCRIQ-FITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKV 67
Query  68   VGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAK 125
             G HED  C+I LVKS   +CSEIP       Q +KV L+ N       R+   L F  K
Sbjct  68   DGDHEDDICQIVLVKSPGQECSEIPNDVYSE-QAAKVTLTSNNGEASDVRNANALGFLKK 126
Query  126  TDAPGC 131
               P C
Sbjct  127  APLPEC 132

Sequence Alignment: 19. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 72.7 bits 232,  Expect = 4e-15
 Identities = 46/112 41%, Positives = 67/112 59%, Gaps = 10/112 8%
Query  14   EVYCNVCHSRNLINELSERMAGAQVQLDCKDDSK-KVIYSIGGETGQDGVYRLPVVGYHE 72
            +VYC+ C +  +I ELSE + GA V+L CK+     + ++  G T  +G+Y + V   H+
Sbjct  1    QVYCDTCRA-GFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHK 59
Query  73   D--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSFRAKTDAP 129
            +  CEI L+ SG  DC+EIP   +G  + S K  L+   T+   TR V PL F  K   P
Sbjct  60   NEFCEITLISSGSKDCNEIP--TEGWAKPSLKFILN---TVNGTTRTVNPLGFFKKEALP 114
Query  130  GC 131
             C
Sbjct  115  KC 116

Sequence Alignment: 20. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 71.4 bits 228,  Expect = 1e-14
 Identities = 42/123 34%, Positives = 65/123 52%, Gaps = 5/123 4%
Query  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYRL 65
            ++FH++G VYC+ C  + ++  +S  M GA V+L+C++ +     +     T + G Y +
Sbjct  28   SQFHIQGLVYCDTCRIQ-FMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSI 86
Query  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
            PV G  ED  CEI+LVKS   +CSE+        Q++KV L+ N       R    L F 
Sbjct  87   PVNGDFEDDICEIELVKSPNSECSEVSHDVYAK-QSAKVSLTSNNGEASDIRSANALGFM 145
Query  124  AKTDAPGC 131
             K     C
Sbjct  146  RKEPLEEC 153

Sequence Alignment: 21. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 68.3 bits 217,  Expect = 1e-13
 Identities = 42/121 34%, Positives = 62/121 51%, Gaps = 5/121 4%
Query  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYRLPV 67
            F V+G VYC+ C  + ++  +S  M GA V+L+C++ +     +     T + G Y +PV
Sbjct  30   FKVQGMVYCDTCRIQ-FMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPV 88
Query  68   VGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAK 125
             G  ED  CEI+LVKS   +CSE+        Q++KV L+ N       R    L F  K
Sbjct  89   NGDFEDDICEIELVKSPNSECSEVSHDVYAK-QSAKVSLTSNNGEASDIRSANALGFMRK 147
Query  126  TDAPGC 131
                 C
Sbjct  148  EPLKEC 153

Sequence Alignment: 22. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 63.4 bits 200,  Expect = 3e-12
 Identities = 40/121 33%, Positives = 63/121 52%, Gaps = 8/121 6%
Query  7    AKFHVEGEVYCNVC-HSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYR 64
            ++FH++G VYC+ C +  + +  + E   GA V+L+C++ +     +     T + G Y 
Sbjct  28   SQFHIQGLVYCDTCPYPSSYVLPMLE---GATVKLECRNITAGTQTFKAEAVTDKVGQYS 84
Query  65   LPVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSF 122
            +PV G  ED  CEI+L+KS    CSE+        Q++KV L+ N       R    L F
Sbjct  85   IPVDGDFEDDICEIELLKSPDNQCSEVSHDVYAK-QSAKVSLTSNNGEASDVRSANALGF 143
Query  123  RAKTDAPGC 131
              K     C
Sbjct  144  MRKEPLEEC 152

Sequence Alignment: 23. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 59.6 bits 186,  Expect = 3e-11
 Identities = 37/118 31%, Positives = 62/118 52%, Gaps = 9/118 7%
Query  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRLPV 67
            F V G VYC+ C +  +   +S  + GA V +DC+  D  +        T +DG Y++ +
Sbjct  6    FVVTGRVYCDPCRA-GFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEI 64
Query  68   VGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEK-TRHVKPLSFRA 124
               H++  CE+ L KS    CSEI ++       ++V L+ N  I ++  R+  P++F  
Sbjct  65   DQDHQEEICEVVLAKSPDKSCSEIEEFR----DRARVPLTSNXGIKQQGIRYANPIAFFR 120
Query  125  KTDAPGC 131
            K     C
Sbjct  121  KEPLKEC 127

Sequence Alignment: 24. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 53.0 bits 163,  Expect = 3e-09
 Identities = 36/117 30%, Positives = 62/117 52%, Gaps = 11/117 9%
Query  9    FHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETGQDGV--YRLP 66
            F V G VYC+ C +  +   +S  + GA V +DC+  +      +  E   DG+  Y++ 
Sbjct  6    FVVTGRVYCDPCRA-GFETNVSHNVQGATVAVDCRPFNGGE-SKLKAEATTDGLGWYKIE 63
Query  67   VVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEK-TRHVKPLSFR 123
            +   H++  CE+ L KS    CSEI ++       ++V L+ N  I ++  R+  P++F 
Sbjct  64   IDQDHQEEICEVVLAKSPDTTCSEIEEFR----DRARVPLTSNNGIKQQGIRYANPIAFF 119
Query  124  AKTDAPGC 131
             K     C
Sbjct  120  RKEPLKEC 127

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.