The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VDYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGL
ETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSST
AAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNN
WYTHYLVCNYGPAGNFGNQEVYERK
Sequence Info Allergen Name Length Opt Bits Score E Value
P35786 Ves s 5 205 1437 382.9 3.7e-108
P35787 Ves vi 5 206 1219 325.8 5.7e-91
P35785 Ves p 5 204 1105 296.0 5.4e-82
P35760 Ves m 5 204 1089 291.8 9.9e-81
Q05110 Ves v 5 227 1080 289.4 5.8e-80
P35783 Ves f 5 204 1074 287.9 1.5e-79
P35784 Ves g 5 204 1070 286.8 3.1e-79
P0DMB9 Vesp v 5.0101 202 1039 278.7 8.5e-77
Q05108 Dol a 5 203 1032 276.9 3e-76
P35781 Vesp c 5 202 1025 275.0 1.1e-75
P10737 Dol m 5.02 215 1020 273.7 2.9e-75
P10736 Dol m 5.0101 227 1018 273.2 4.4e-75
P35782 Vesp c 5 202 1007 270.3 2.8e-74
P81657 Vesp m 5 202 1006 270.1 3.4e-74
AAA28302 Dol m 5.02 212 1001 268.7 8.9e-74
P81656 Pol d 5 206 888 239.2 6.9e-65
P35780 Pol f 5 205 887 238.9 8.3e-65
Q05109 Pol a 5 209 887 238.9 8.5e-65
P35759 Pol e 5.0101 205 883 237.9 1.7e-64
P83377 Pol g 5 206 882 237.6 2.1e-64
C0HJV9 Poly p 5.0101 206 871 234.7 1.5e-63
Q7Z156 Poly s 5.0101 207 870 234.5 1.8e-63
AAT95009 Pol e 5.0101 226 867 233.6 3.5e-63
P86686 Poly p 5.0102 207 853 230.0 4e-62
C0ITL3 Pac c 3.0101 199 713 193.4 4.1e-51
P35779 Sol r 3 211 678 184.2 2.5e-48
P35778 Sol i 3 234 658 178.9 1.1e-46
QEA69430 Sco m 5.0101 210 350 98.3 1.8e-22
AAF65314 Cte f 2 264 281 80.2 6.6e-17
AAF82096 Glo m 5 259 259 74.4 3.5e-15
ABC58726 Sol s 3.0101 90 251 72.7 4e-15
AAY32926 Sol g 3.0101 70 245 71.2 8.7e-15
AAU15051 Cyn d 24.0101 153 187 55.7 8.6e-10
AVD29826 Art la 2.0101 163 181 54.1 2.8e-09
A0A2L1DGQ3 Art ar 2.0101 163 181 54.1 2.8e-09
AVD29827 Art si 2.0101 163 181 54.1 2.8e-09
AVD29822 Art an 2.0101 163 181 54.1 2.8e-09
AVD29824 Art ca 2.0101 163 181 54.1 2.8e-09
AVD29825 Art gm 2.0101 163 181 54.1 2.8e-09
7065471 Pol m 5.0101 37 168 51.2 4.7e-09
ADM18345 Tab y 5.0101 256 180 53.7 5.8e-09
XP_007199020 Pru p 9.0101 161 127 40.0 4.9e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 382.9 bits 1437,  Expect = 4e-108
 Identities = 205/205 100%, Positives = 205/205 100%, Gaps = 0/205 0%
Query  1    VDYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGL 60
            VDYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGL
Sbjct  1    VDYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGL 60
Query  61   ETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSST 120
            ETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSST
Sbjct  61   ETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSST 120
Query  121  AAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNN 180
            AAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNN
Sbjct  121  AAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNN 180
Query  181  WYTHYLVCNYGPAGNFGNQEVYERK 205
            WYTHYLVCNYGPAGNFGNQEVYERK
Sbjct  181  WYTHYLVCNYGPAGNFGNQEVYERK 205

Sequence Alignment: 2. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 325.8 bits 1219,  Expect = 6e-91
 Identities = 165/205 80%, Positives = 187/205 91%, Gaps = 0/205 0%
Query  1    VDYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGL 60
            V+YCKIKCLKGGVHTACKYGTSTKPNCG MVVK+YG+T+AEKQEILK+HNDFR KVA+GL
Sbjct  2    VNYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGL 61
Query  61   ETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSST 120
            ETRGNPGPQPPAKNMNNLVWN+ELANIAQ+WASQC YGHDTCKDT KY VGQNIA  S+T
Sbjct  62   ETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTT 121
Query  121  AAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNN 180
            AA++++ G LVK WENEVKDFNP I W +N +KK GHYTQMVWAKTKEIGCGS+KYV + 
Sbjct  122  AALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDE 181
Query  181  WYTHYLVCNYGPAGNFGNQEVYERK 205
            WYTHYLVCNYGP+GNF N+++YE+K
Sbjct  182  WYTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 3. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 296.0 bits 1105,  Expect = 5e-82
 Identities = 148/203 72%, Positives = 174/203 85%, Gaps = 1/203 0%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKCLKGGVHTACKYG S KPNCGN +V SYG+T+ EKQ+ILK HNDFR K+ARGLE
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKPNCGNKIVVSYGLTKEEKQDILKEHNDFRQKIARGLE 60
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAKNM NLVWN+ELA +AQ+WA+QC+YGHDTC+D  KY VGQN+A++ STA
Sbjct  61   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYPVGQNVALTGSTA 120
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
              Y+N   LVK WE+EVKD+NP   + +N F KIGHYTQMVWA TKEIGCGSIKY+ N W
Sbjct  121  DKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNKIGHYTQMVWANTKEIGCGSIKYIQNEW 180
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            + HYLVCNYGP+GNFGN+E+Y+ K
Sbjct  181  HKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 4. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 291.8 bits 1089,  Expect = 1e-80
 Identities = 147/203 72%, Positives = 173/203 85%, Gaps = 1/203 0%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKCLKGGVHTACKYG S KPNCGN  V SYG+T+ EKQ+ILK HNDFR K+ARGLE
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAKNM NLVW++ELA IAQ+WA+QC+YGHDTC+D  KY VGQN+A++ STA
Sbjct  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 120
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
            AVY +   LVK WE+EVKD+NP   + +N F KIGHYTQMVWA TKE+GCGSIKY+  NW
Sbjct  121  AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW 180
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            + HYLVCNYGP+GNF N+E+Y+ K
Sbjct  181  HKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 5. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 289.4 bits 1080,  Expect = 6e-80
 Identities = 145/203 71%, Positives = 172/203 84%, Gaps = 1/203 0%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKCLKGGVHTACKYG S KPNCGN VV SYG+T+ EKQ+ILK HNDFR K+ARGLE
Sbjct  25   NYCKIKCLKGGVHTACKYG-SLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLE 83
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAKNM NLVWN+ELA +AQ+WA+QC+YGHDTC+D  KY VGQN+A++ STA
Sbjct  84   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 143
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
            A Y++   LVK WE+EVKD+NP   +  N+F K GHYTQMVWA TKE+GCGSIKY+   W
Sbjct  144  AKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYIQEKW 203
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            + HYLVCNYGP+GNF N+E+Y+ K
Sbjct  204  HKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 6. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 287.9 bits 1074,  Expect = 2e-79
 Identities = 144/203 70%, Positives = 171/203 84%, Gaps = 1/203 0%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKCLKGGVHTACKYG S KPNCGN VV SYG+T+ EKQ+ILK HNDFR K+ARGLE
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAKNM NLVWN+ELA +AQ+WA+QC+YGHDTC+D  KY VGQN+A++ STA
Sbjct  61   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDIAKYQVGQNVALTGSTA 120
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
            A Y++   LVK WE+EVKD+NP   +  N F K GHYTQMVWA TKE+GCGSIK++   W
Sbjct  121  AKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLKTGHYTQMVWANTKEVGCGSIKFIQEKW 180
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            + HYLVCNYGP+GNF N+E+Y+ K
Sbjct  181  HKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 7. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 286.8 bits 1070,  Expect = 3e-79
 Identities = 144/203 70%, Positives = 172/203 84%, Gaps = 1/203 0%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKCLKGGVHTACKY  S KPNC N  V +YG+T+ EKQ+ILK HNDFR K+ARGLE
Sbjct  2    NYCKIKCLKGGVHTACKY-ESLKPNCANKKVVAYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAKNM NLVW++ELA IAQ+WA+QC+YGHDTC+D  KY VGQN+A++ STA
Sbjct  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYPVGQNVALTGSTA 120
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
            A Y+N   LVK WE+EVKD+NP   + +N F KIGHYTQMVWA TKE+GCGSIKY+ + W
Sbjct  121  AKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQDKW 180
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            + HYLVCNYGP+GNFGN+E+Y+ K
Sbjct  181  HKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 8. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 278.7 bits 1039,  Expect = 9e-77
 Identities = 143/201 71%, Positives = 171/201 85%, Gaps = 3/201 1%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKC + G+HT CKYGTSTKPNCG  VVK+ G+T+AEK EILK HN+FR KVARGLE
Sbjct  2    NYCKIKC-RSGIHTLCKYGTSTKPNCGRSVVKASGLTKAEKLEILKQHNEFRQKVARGLE 60
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAK+MN LVWN+ELA IAQ+WASQCKYGHD C++T KY VGQNIA  S+TA
Sbjct  61   TRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYGHDNCRNTAKYLVGQNIAEQSTTA 120
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
            A +E V N+VK W +EVKD+    S  +N++  +GHYTQMVWAKTKEIGCG+IKY++N W
Sbjct  121  ASFEPVSNMVKMWSDEVKDYQYGSS--KNKLNDVGHYTQMVWAKTKEIGCGNIKYIENGW 178
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            + HYLVCNYGPAGN GN+ +YE+K
Sbjct  179  HHHYLVCNYGPAGNIGNEPIYEKK 202

Sequence Alignment: 9. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 276.9 bits 1032,  Expect = 3e-76
 Identities = 140/202 69%, Positives = 166/202 82%, Gaps = 2/202 0%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKI C KG  HT CKYGTS KPNCG  +VKSYGVT  EK EI+K HN+FR KVA+GLE
Sbjct  2    NYCKI-CPKG-THTLCKYGTSMKPNCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQGLE 59
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAKNMN LVWN+ELA IAQ WA+QC +GHD C++T KY VGQN+A++S+T 
Sbjct  60   TRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFGHDQCRNTAKYPVGQNVAIASTTG 119
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
              Y+ +  L+K WE+EVKD+NP     +N F K+GHYTQMVW KTKEIGCGS+KY++N W
Sbjct  120  NSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSKVGHYTQMVWGKTKEIGCGSVKYIENKW 179
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            +THYLVCNYGPAGN+ NQ VYERK
Sbjct  180  HTHYLVCNYGPAGNYMNQPVYERK 203

Sequence Alignment: 10. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 275.0 bits 1025,  Expect = 1e-75
 Identities = 139/201 69%, Positives = 169/201 84%, Gaps = 3/201 1%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKC + G+HT CKYGTSTKPNCG  VVK+ G+T+ E  EILK HN+FR KVARGLE
Sbjct  2    NYCKIKC-RSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARGLE 60
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAK+MN LVWN+ELA IAQ+WA+QC YGHD C+++ KY+VGQNIA  S+TA
Sbjct  61   TRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGSTTA 120
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
              + +V N+VK WE+EVKD+       +N++ K+GHYTQMVWAKTKEIGCGSIKY++N W
Sbjct  121  DNFGSVSNMVKMWEDEVKDYQ--YGSPKNKLNKVGHYTQMVWAKTKEIGCGSIKYIENGW 178
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            + HYLVCNYGPAGN GN+ +YERK
Sbjct  179  HRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 11. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 273.7 bits 1020,  Expect = 3e-75
 Identities = 135/203 66%, Positives = 166/203 81%, Gaps = 2/203 0%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKC +G +HT CK+GTS KPNCG+ +VK +GV+  EK EI+  HN FR KVA+GLE
Sbjct  12   NYCKIKCSRG-IHTLCKFGTSMKPNCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGLE 70
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAKNMN LVWN+ELA IAQ WA+QC +GHD C++T KY VGQN+A++S+T 
Sbjct  71   TRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKYQVGQNVAIASTTG 130
Query  122  AVYENVGNLVKAWENEVKDFNPTI-SWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNN 180
              Y  +  L++ WENEVKDFNP   +   N F K+GHYTQMVW KTKEIGCGS+KY++NN
Sbjct  131  NSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENN 190
Query  181  WYTHYLVCNYGPAGNFGNQEVYERK 205
            W+THYLVCNYGPAGN+ +Q +YERK
Sbjct  191  WHTHYLVCNYGPAGNYMDQPIYERK 215

Sequence Alignment: 12. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 273.2 bits 1018,  Expect = 4e-75
 Identities = 137/203 67%, Positives = 164/203 80%, Gaps = 1/203 0%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKC KG +HT CK+GTS KPNCG  VVK+YG+T  EK EILK HNDFR  VA+GLE
Sbjct  25   NYCKIKCRKG-IHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLE 83
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRG PGPQPPAKNMN LVWN+ELA IAQ WA+QC + HD C++T KY VGQNIA+SS+TA
Sbjct  84   TRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTA 143
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
              ++    L+K WE+EV +FN  +  + + F+K+GHYTQMVW KTKEIGCGSIKY+++NW
Sbjct  144  TQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDNW 203
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            YTHYLVCNYGP GN  NQ +YERK
Sbjct  204  YTHYLVCNYGPGGNDFNQPIYERK 227

Sequence Alignment: 13. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 270.3 bits 1007,  Expect = 3e-74
 Identities = 136/201 67%, Positives = 167/201 83%, Gaps = 3/201 1%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKC + G+HT CKYGTSTKPNCG  VVK+ G+T+ E  EILK HN+FR KVARGLE
Sbjct  2    NYCKIKC-RSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARGLE 60
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAK+MN LVWN+ELA IAQ+WA+QC YGHD C+++ KY+VGQNIA  S++A
Sbjct  61   TRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGSTSA 120
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
              + NV N+VK WE+EVKD+       +N++ K+GHYTQMVWAKTKEIGCGS  Y+++ W
Sbjct  121  DNFVNVSNMVKMWEDEVKDYQ--YGSPKNKLNKVGHYTQMVWAKTKEIGCGSEDYIEDGW 178
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            + HYLVCNYGPAGN GN+ +YERK
Sbjct  179  HRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 14. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 270.1 bits 1006,  Expect = 3e-74
 Identities = 136/201 67%, Positives = 168/201 83%, Gaps = 3/201 1%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKC + G+HT CK+G STKPNCG  VVK+ G+T+AEK EILK HN+FR KVARGLE
Sbjct  2    NYCKIKC-RSGIHTLCKFGISTKPNCGKNVVKASGLTKAEKLEILKQHNEFRQKVARGLE 60
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRG PGPQPPAK+MN LVWN+ELA IAQ+WA QC YGHD C++T KY+VGQNIA + STA
Sbjct  61   TRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYGHDVCRNTAKYSVGQNIAENGSTA 120
Query  122  AVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNW 181
            A + +V N+V+ W +EVK++       +N++ ++GHYTQMVWAKTKEIGCGSIKY++N W
Sbjct  121  ASFASVSNMVQMWADEVKNYQ--YGSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIENGW 178
Query  182  YTHYLVCNYGPAGNFGNQEVYERK 205
            + HYLVCNYGPAGN GN+ +YERK
Sbjct  179  HRHYLVCNYGPAGNIGNEPIYERK 202

Sequence Alignment: 15. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 268.7 bits 1001,  Expect = 9e-74
 Identities = 132/200 66%, Positives = 163/200 81%, Gaps = 2/200 1%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            +YCKIKC +G +HT CK+GTS KPNCG+ +VK +GV+  EK EI+  HN FR KVA+GLE
Sbjct  12   NYCKIKCSRG-IHTLCKFGTSMKPNCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGLE 70
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTA 121
            TRGNPGPQPPAKNMN LVWN+ELA IAQ WA+QC +GHD C++T KY VGQN+A++S+T 
Sbjct  71   TRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKYQVGQNVAIASTTG 130
Query  122  AVYENVGNLVKAWENEVKDFNPTI-SWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNN 180
              Y  +  L++ WENEVKDFNP   +   N F K+GHYTQMVW KTKEIGCGS+KY++NN
Sbjct  131  NSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENN 190
Query  181  WYTHYLVCNYGPAGNFGNQEVY 202
            W+THYLVCNYGPAGN+ +Q +Y
Sbjct  191  WHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 16. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 239.2 bits 888,  Expect = 7e-65
 Identities = 125/202 61%, Positives = 152/202 75%, Gaps = 5/202 2%
Query  2    DYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARG 59
            DYCKIKC   GVHT C+YG STKP  NC   ++KS G T+ EK+ I++ HN FR KVA+G
Sbjct  2    DYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
Query  60   LETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVSS 118
            LETRGNPGPQP A NMNNLVWN+ELA IAQ+WASQC+   HD C++T KY VGQNIA + 
Sbjct  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
Query  119  STAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVD 178
            S+   + +V  L++ WENEVKDFN         F K+GHYTQMVW  TKE+GCGS+KYV+
Sbjct  121  SSNH-FPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
Query  179  NNWYTHYLVCNYGPAGNFGNQEVYERK 205
             N   HYL+CNYGPAGN+  Q +Y +K
Sbjct  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 17. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 238.9 bits 887,  Expect = 8e-65
 Identities = 127/202 62%, Positives = 155/202 76%, Gaps = 6/202 2%
Query  1    VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
            VDYCKIKC   G+HT C+YG STKP  NC + V+KS G T+ EK+ I+  HN FR KVA+
Sbjct  1    VDYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQ 59
Query  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVS 117
            GLETRGNPGPQP A +MNNLVWN+ELA+IAQ+WASQC+   HD C++T KY VGQNIA +
Sbjct  60   GLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYA 119
Query  118  SSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYV 177
              +     +V +L+K WENEVKDFN      +  F K+GHYTQM+WAKTKEIGCGS+KY+
Sbjct  120  GGSK--LPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYM 177
Query  178  DNNWYTHYLVCNYGPAGNFGNQEVYERK 205
             NN   HYL+CNYGPAGN+  Q  Y +K
Sbjct  178  KNNMQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 18. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 238.9 bits 887,  Expect = 8e-65
 Identities = 127/202 62%, Positives = 155/202 76%, Gaps = 6/202 2%
Query  1    VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
            VDYCKIKC   G+HT C+YG STKP  NC   V+KS G T+ EK+ I+  HN FR KVA+
Sbjct  5    VDYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 63
Query  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVS 117
            GLETRGNPGPQP A +MN+LVWN+ELA+IAQ+WASQC++  HD C++T KY VGQNIA +
Sbjct  64   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYA 123
Query  118  SSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYV 177
              +     +V +L+K WENEVKDFN      +  F KIGHYTQMVW KTKEIGCGS+KY+
Sbjct  124  GGSN--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYM 181
Query  178  DNNWYTHYLVCNYGPAGNFGNQEVYERK 205
            +NN   HYL+CNYGPAGN+  Q  Y +K
Sbjct  182  ENNMQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 19. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 237.9 bits 883,  Expect = 2e-64
 Identities = 126/202 62%, Positives = 154/202 76%, Gaps = 6/202 2%
Query  1    VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
            VDYCKIKC   G+HT C+YG STKP  NC   V+KS G T+ EK+ I+  HN FR KVA+
Sbjct  1    VDYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 59
Query  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVS 117
            GLETRGNPGPQP A +MN+LVWN+ELA+IAQ+WASQC++  HD C++T KY VGQNIA +
Sbjct  60   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYA 119
Query  118  SSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYV 177
              +     +V +L+K WENEVKDFN      +  F KIGHYTQMVW KTKEIGCGS+KY+
Sbjct  120  GGSK--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYI 177
Query  178  DNNWYTHYLVCNYGPAGNFGNQEVYERK 205
            +N    HYL+CNYGPAGN+  Q  Y +K
Sbjct  178  ENKMQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 20. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 237.6 bits 882,  Expect = 2e-64
 Identities = 125/202 61%, Positives = 151/202 74%, Gaps = 5/202 2%
Query  2    DYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARG 59
            DYCKIKC   GVHT C+YG STKP  NC   V+KS G T+ EK+ I++ HN FR KVA+G
Sbjct  2    DYCKIKC-SSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVAQG 60
Query  60   LETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVSS 118
            LETRGNPGPQP A NMNNLVWN+E A IAQ+WASQC+   HD C++T KY VGQNIA + 
Sbjct  61   LETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAG 120
Query  119  STAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVD 178
            S+   + +V  L++ WENEVKDFN         F K+GHYTQMVW  TKE+GCGS+KYV+
Sbjct  121  SSNH-FPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
Query  179  NNWYTHYLVCNYGPAGNFGNQEVYERK 205
             N   HYL+CNYGPAGN+  Q +Y +K
Sbjct  180  KNMKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 21. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 234.7 bits 871,  Expect = 2e-63
 Identities = 124/201 61%, Positives = 155/201 77%, Gaps = 5/201 2%
Query  3    YCKIKCLKGGVHTACKYGTSTKPN--CGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGL 60
            YC IKC K   HT C+YG STKP+  C  + + S GVT+ EK+ I+  HN FR KVA+GL
Sbjct  3    YCNIKCSKVA-HTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 61
Query  61   ETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVSSS 119
            ETRGNPGPQP A +MNNLVWN+ELA IAQ+WASQC++  HD C++T +Y VGQNIA S+S
Sbjct  62   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAS 121
Query  120  TAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDN 179
            TAA Y  + +L+  WENEVKDFN +    +  F K+GHYTQ+VWAKTKE+GCGSIKY++ 
Sbjct  122  TAA-YPGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAKTKEVGCGSIKYIEK 180
Query  180  NWYTHYLVCNYGPAGNFGNQEVYERK 205
               +HYLVCNYGPAGN+  Q +Y +K
Sbjct  181  GMKSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 22. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 234.5 bits 870,  Expect = 2e-63
 Identities = 124/201 61%, Positives = 155/201 77%, Gaps = 6/201 2%
Query  3    YCKIKCLKGGVHTACKYGTSTKP---NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARG 59
            YC IKC K   HT C+YG STKP   NC  + + S GVT+ EK+ I+  HN FR KVA+G
Sbjct  3    YCNIKCSKVA-HTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQG 61
Query  60   LETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVSS 118
            LETRGNPGPQP A +MNNLVWN+ELA IAQ+WA+QC++  HD C++T +Y VGQNIA S+
Sbjct  62   LETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSA 121
Query  119  STAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVD 178
            STAA Y  + +L+  WENEVKDFN +    +  F K+GHYTQ+VWAKTKE+GCGSIKY++
Sbjct  122  STAA-YPGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIE 180
Query  179  NNWYTHYLVCNYGPAGNFGNQEVYERK 205
                +HYLVCNYGPAGN+  Q +Y +K
Sbjct  181  KGMKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 23. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 233.6 bits 867,  Expect = 4e-63
 Identities = 123/196 62%, Positives = 151/196 77%, Gaps = 6/196 3%
Query  1    VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
            VDYCKI+C   G+HT C+YG STKP  NC   V+KS G T+ EK+ I+  HN FR KVA+
Sbjct  22   VDYCKIRC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 80
Query  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVS 117
            GLETRGNPGPQP A +MN+LVWN+ELA+IAQ+WASQC++  HD C++T KY VGQNIA +
Sbjct  81   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYA 140
Query  118  SSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYV 177
              +     +V +L+K WENEVKDFN      +  F KIGHYTQMVW KTKEIGCGS+KY+
Sbjct  141  GGSK--LPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYM 198
Query  178  DNNWYTHYLVCNYGPAGNFGNQ 199
            +N    HYL+CNYGPAGN+  Q
Sbjct  199  ENKMQNHYLICNYGPAGNYLGQ 220

Sequence Alignment: 24. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 230.0 bits 853,  Expect = 4e-62
 Identities = 125/201 62%, Positives = 151/201 75%, Gaps = 6/201 2%
Query  3    YCKIKCLKGGVHTACKYGTSTKP---NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARG 59
            YC IKC K   HT C+ G STKP   NC  + + S GVT+ EK+ I+  HN FR KVA+G
Sbjct  3    YCNIKCSKVA-HTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQG 61
Query  60   LETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVSS 118
            LETRGNPGPQP A +MNNLVWN+ELA IAQ+WASQC++  HD C++T +Y VGQNIA S+
Sbjct  62   LETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSA 121
Query  119  STAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVD 178
            STAA Y  V  L+  WENEVKDFN      +  F K+GHYTQ+VWAKTKE+GCGSIKY++
Sbjct  122  STAA-YPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIE 180
Query  179  NNWYTHYLVCNYGPAGNFGNQEVYERK 205
                +HYLVCNYGPAGN    ++YE K
Sbjct  181  KGMKSHYLVCNYGPAGNVLGAQIYEIK 207

Sequence Alignment: 25. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 193.4 bits 713,  Expect = 4e-51
 Identities = 103/191 53%, Positives = 132/191 69%, Gaps = 7/191 3%
Query  11   GGVHTACKYGT-STKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLETRGNPGPQ 69
            G VHT C+Y +    PNCG     +  +T A+K+ ILK+HND R KV  G ETRGNPGPQ
Sbjct  4    GAVHTMCQYTSPQPSPNCGTY--SNAHITAADKETILKVHNDERQKVKAGQETRGNPGPQ 61
Query  70   PPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTAAVYENVGN 129
            P A NM +L W+NELA IAQ W +QCK GHD C++  +Y VGQNIA+S STA    N+ N
Sbjct  62   PAASNMPDLTWDNELAAIAQRWVNQCKIGHDGCRNVERYQVGQNIAMSGSTAKGPCNMNN 121
Query  130  LVKAWENEVKDFNP----TISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNWYTHY 185
            LV+ W NEV  +N     ++  + N F KIGHYTQ+VW KT ++GCG I+++D  +Y  Y
Sbjct  122  LVQMWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCY 181
Query  186  LVCNYGPAGNFGNQEVYE 203
            L CNYGPAGN     +Y+
Sbjct  182  LACNYGPAGNMFGAPIYQ 199

Sequence Alignment: 26. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 184.2 bits 678,  Expect = 3e-48
 Identities = 97/202 48%, Positives = 134/202 66%, Gaps = 9/202 4%
Query  2    DYCKIKCLK--GGVHTACKYGTSTK-PNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
            +YC ++  K    +HT C+Y + T  P C  +   + G T AEK  I+  HN++R +VA 
Sbjct  2    NYCNLQSCKRNNAIHTMCQYTSPTPGPMC--LEYSNVGFTDAEKDAIVNKHNELRQRVAS 59
Query  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSS 118
            G E RG  GPQPPA  M NL W+ ELA IAQ WA+QC + HD C++  ++ VGQNIA +S
Sbjct  60   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATS 119
Query  119  STAAVYENVGNLVKAWENEVKDFN----PTISWEQNEFKKIGHYTQMVWAKTKEIGCGSI 174
            S+      + +++  W NEVKDF+     +   + N +  +GHYTQ+VWAKTK+IGCG I
Sbjct  120  SSGKNKSTLSDMILLWYNEVKDFDNRWISSFPSDGNILMHVGHYTQIVWAKTKKIGCGRI 179
Query  175  KYVDNNWYTHYLVCNYGPAGNFGNQEVYERK 205
             + ++NW  HYLVCNYGPAGN    ++YE K
Sbjct  180  MFKEDNWNKHYLVCNYGPAGNVLGAQIYEIK 210

Sequence Alignment: 27. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 178.9 bits 658,  Expect = 1e-46
 Identities = 97/202 48%, Positives = 131/202 64%, Gaps = 10/202 4%
Query  2    DYCKIKCLK--GGVHTACKYGTSTK-PNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
            +YC ++  K    +HT C+Y + T  P C  +   + G T AEK  I+  HN++R +VA 
Sbjct  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMC--LEYSNVGFTDAEKDAIVNKHNELRQRVAS 81
Query  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSS 118
            G E RG  GPQPPA  M NL W+ ELA IAQ WA+QC + HD C++  ++ VGQNIA +S
Sbjct  82   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATS 141
Query  119  STAAVYENVGNLVKAWENEVKDFN----PTISWEQNEFKKIGHYTQMVWAKTKEIGCGSI 174
            S+         ++  W NEVKDF+     +   + N + K+GHYTQ+VWAKT +IGCG I
Sbjct  142  SSGKNKSTPNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCGRI 201
Query  175  KYVD-NNWYTHYLVCNYGPAGNFGNQEVYERK 205
             + + +NW  HYLVCNYGPAGN     +YE K
Sbjct  202  MFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233

Sequence Alignment: 28. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 98.3 bits 350,  Expect = 2e-22
 Identities = 65/158 41%, Positives = 97/158 61%, Gaps = 22/158 13%
Query  32   VKSYGVTQAEKQEILKIHNDFRNKVARGLETRGNPGPQPPAKNMNNLVWNNELANIAQIW 91
            +K  G+    K+ IL +HN  R  VA G ++ G    QP A NM  L W++++A  AQ  
Sbjct  26   MKVRGLDANMKKMILDLHNKKRQTVANGQQS-G----QPSAANMKELHWDDQIAANAQRS 80
Query  92   ASQCKYGHDT--CKDTTKYN-VGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWE 148
            A  C + H     + T+KY+ +G+NI + S    +  +V     AW +EVKD  P +   
Sbjct  81   AETCVFQHTAKNLRKTSKYSYLGENIYMGSYPDPIPRSVN----AWYDEVKDVTPAVV-- 134
Query  149  QNEFKK----IGHYTQMVWAKTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQEVYER 204
               F+     IGHYTQMVWA T+ +GCG +   D N    Y+ C YGP+GN+  + +Y++
Sbjct  135  -KSFRSGGPMIGHYTQMVWANTEALGCGLVTASDKN---TYIFCQYGPSGNYPGEPIYKQ 190

Sequence Alignment: 29. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 80.2 bits 281,  Expect = 7e-17
 Identities = 70/194 36%, Positives = 98/194 50%, Gaps = 25/194 12%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPN----CGNMVVKSYGVTQAEKQEILKIHNDFRNKVA 57
            DYC + C  G  +  C     TKP+    C N   K   +T+  K+  L  HN  R  VA
Sbjct  33   DYCNLNCTNGP-NVGC-----TKPDVPRDCQNF--KLVNITERMKKAFLNAHNRKRRLVA 84
Query  58   RGLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVS 117
             G     +    P A  M NL WN  LA +A+    QC+  HD C  T   + GQN+   
Sbjct  85   AGKGLLKDGVHTPIAAKMPNLTWNIALAKLAEYNVKQCEMKHD-CAKTRHGHTGQNLFFY 143
Query  118  SSTAAVYEN--VGNL-VKAWENEVKDFN----PTISWEQNEFKKIGHYTQMVWAKTKEIG 170
             +T +  +N  +  + V  W  E KD        ++      K IGHYTQ++W  T ++G
Sbjct  144  GTTLSPIKNSTIAKMAVDGWYAESKDTRLEDIKKLTTIYPNGKPIGHYTQLIWGNTTKVG 203
Query  171  CGSI---KYVDNNWYTHYLV-CNYGPAGNFGNQEVYERK 205
            C      K+ + N +   LV CNY   GN   + VY+ K
Sbjct  204  CAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIK 241

Sequence Alignment: 30. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 74.4 bits 259,  Expect = 3e-15
 Identities = 61/178 34%, Positives = 94/178 52%, Gaps = 20/178 11%
Query  2    DYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGLE 61
            DYC + C     H AC      +  C +   K   + + +   +L  HN  RN VA G E
Sbjct  21   DYCGL-C---DNHDACVMQNVFQSGCPSGA-KMIDLNKYQSA-LLDAHNKKRNHVAGGGE 74
Query  62   TRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYN-VGQNIAVSSST 120
            ++        A  M  + W++ELA +A+    QC+  HD C++T K+   GQN+A    +
Sbjct  75   SK-----LKRACQMATMKWDSELAKLAEYNVKQCQMNHDRCRNTVKFKYAGQNLAELGRS 129
Query  121  AAVYENVGNLV-KA---WENEVKDFNPTI--SWEQN-EFKKIGHYTQMVWAKTKEIGCGS 173
                 +   L+ KA   W  EVKD N     S+  N     IGH+T MV  +   +GC +
Sbjct  130  GGPPPDYRKLIEKAVDKWYEEVKDCNQGYIDSYPMNYRGPAIGHFTVMVAERNTHVGCAA 189
Query  174  IKYVDNNWYTHYLV-CNY 190
             +Y  +N + ++L+ CNY
Sbjct  190  SEYTKSNGFQYFLMACNY 207

Sequence Alignment: 31. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 72.7 bits 251,  Expect = 4e-15
 Identities = 40/86 46%, Positives = 54/86 62%, Gaps = 5/86 5%
Query  2    DYCKIK-CLKGG-VHTACKYGTSTK-PNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
            +YC ++ C +   +HT C+Y + T  P C  +   + G T AEK  I+  HN++R +VA 
Sbjct  2    NYCNLQSCKRNNAIHTMCQYTSPTPGPMC--LEYSNVGFTDAEKDAIVNKHNELRQRVAS 59
Query  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQ 89
            G E RG   PQPPA  M NL W+ ELA IAQ
Sbjct  60   GKEMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

Sequence Alignment: 32. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 71.2 bits 245,  Expect = 9e-15
 Identities = 35/58 60%, Positives = 44/58 75%, Gaps = 1/58 1%
Query  148  EQNEFKKIGHYTQMVWAKTKEIGCGSIKYVD-NNWYTHYLVCNYGPAGNFGNQEVYERK 205
            + N + KIGHYTQ+VWAKT +IGCG I + + +NW  HYLVCNYGPAGN    ++YE K
Sbjct  11   DPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69

Sequence Alignment: 33. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 55.7 bits 187,  Expect = 9e-10
 Identities = 52/141 36%, Positives = 76/141 53%, Gaps = 27/141 19%
Query  36   GVTQAEKQEILKIHNDFRNKVARGLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQC 95
            G+     Q+IL  HN FR K              PP      L WN  LA  +Q +A + 
Sbjct  12   GLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYA-ES 53
Query  96   KYGHDTCKDT-TKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKK 154
            K   D CK   +    G+N+   S  A  ++     V  W +E K ++   S   ++ K 
Sbjct  54   KLKKD-CKMVHSDSPYGENLMFGSG-AISWKTT---VDTWSDEKKSYHYG-SNTCDQGKM 107
Query  155  IGHYTQMVWAKTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQEVY 202
             GHYT +VW  T  +GCG +   D+   T  ++C+Y P GN+ NQ+ Y
Sbjct  108  CGHYTAVVWKDTTSVGCGRV-LCDDKKDT-MIMCSYWPPGNYENQKPY 153

Sequence Alignment: 34. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 54.1 bits 181,  Expect = 3e-09
 Identities = 55/123 44%, Positives = 73/123 59%, Gaps = 35/123 28%
Query  61   ETRGNPGPQPP----AKN-------MNNLVWNNELANIAQIWAS----QCKYGH-DTCKD 104
            ET G PG  P     A N       M  L W++ELA +AQ WA      C   H D C +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
Query  105  TTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWA 164
                N+ Q  A++ S A         V+ W +E  D++     E    K  GHYTQ+VWA
Sbjct  85   ----NMAQG-AINGSMA---------VQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
Query  165  KTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQEVY 202
             ++ +GCG      N W  + +VCNY P GN   Q+ Y
Sbjct  128  NSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 35. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 54.1 bits 181,  Expect = 3e-09
 Identities = 55/123 44%, Positives = 73/123 59%, Gaps = 35/123 28%
Query  61   ETRGNPGPQPP----AKN-------MNNLVWNNELANIAQIWAS----QCKYGH-DTCKD 104
            ET G PG  P     A N       M  L W++ELA +AQ WA      C   H D C +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
Query  105  TTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWA 164
                N+ Q  A++ S A         V+ W +E  D++     E    K  GHYTQ+VWA
Sbjct  85   ----NMAQG-AINGSMA---------VQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
Query  165  KTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQEVY 202
             ++ +GCG      N W  + +VCNY P GN   Q+ Y
Sbjct  128  NSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 36. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 54.1 bits 181,  Expect = 3e-09
 Identities = 55/123 44%, Positives = 74/123 60%, Gaps = 35/123 28%
Query  61   ETRGNPGPQPP----AKN-------MNNLVWNNELANIAQIWA----SQCKYGH-DTCKD 104
            ET G PG  P     A N       M  L W++ELA +AQ WA    + C   H D C +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAEARTADCSLVHSDRCGE 84
Query  105  TTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWA 164
                N+ Q  A++ S A         V+ W +E  D++     E    K  GHYTQ+VWA
Sbjct  85   ----NMAQG-AINGSMA---------VQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
Query  165  KTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQEVY 202
             ++ +GCG      N W  + +VCNY P GN   Q+ Y
Sbjct  128  NSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 37. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 54.1 bits 181,  Expect = 3e-09
 Identities = 56/123 45%, Positives = 72/123 58%, Gaps = 35/123 28%
Query  61   ETRGNPGPQPP----AKN-------MNNLVWNNELANIAQIWAS----QCKYGH-DTCKD 104
            ET G PG  P     A N       M  L W++ELA +AQ WA      C   H D C +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRCGE 84
Query  105  TTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWA 164
                N+ Q  A++ S A         V+ W +E  D++     E    K  GHYTQ+VWA
Sbjct  85   ----NMAQG-AINGSMA---------VQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
Query  165  KTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQEVY 202
             T+ +GCG      N W  +  VCNY P GN   Q+ Y
Sbjct  128  NTERVGCGRA-LCSNGW-AYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 38. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 54.1 bits 181,  Expect = 3e-09
 Identities = 54/122 44%, Positives = 72/122 59%, Gaps = 35/122 28%
Query  62   TRGNPGPQPP----AKN-------MNNLVWNNELANIAQIWAS----QCKYGH-DTCKDT 105
            T G PG  P     A N       M  L W++ELA +AQ WA      C   H D C + 
Sbjct  26   TYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE- 84
Query  106  TKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAK 165
               N+ Q  A++ S A         V+ W +E  D++     E    K  GHYTQ+VWA 
Sbjct  85   ---NMAQG-AINGSMA---------VQLWLDERLDYDYN---ENKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQEVY 202
            ++ +GCG      N W  + +VCNY P GN   Q+ Y
Sbjct  129  SERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 39. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 54.1 bits 181,  Expect = 3e-09
 Identities = 56/123 45%, Positives = 72/123 58%, Gaps = 35/123 28%
Query  61   ETRGNPGPQPP----AKN-------MNNLVWNNELANIAQIWAS----QCKYGH-DTCKD 104
            ET G PG  P     A N       M  L W++ELA +AQ WA      C   H D C +
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRCGE 84
Query  105  TTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWA 164
                N+ Q  A++ S A         V+ W +E  D++     E    K  GHYTQ+VWA
Sbjct  85   ----NMAQG-AINGSMA---------VQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
Query  165  KTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQEVY 202
             T+ +GCG      N W  +  VCNY P GN   Q+ Y
Sbjct  128  NTERVGCGRA-LCSNGW-AYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 40. Allergen Name: Pol m 5.0101 Sequence ID: 7065471

 Score = 51.2 bits 168,  Expect = 5e-09
 Identities = 24/35 68%, Positives = 28/35 80%, Gaps = 3/35 8%
Query  1    VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYG 36
            VDYCKIKC   G+HT C+YG STKP  NC + V+KS G
Sbjct  1    VDYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 41. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 53.7 bits 180,  Expect = 6e-09
 Identities = 51/192 26%, Positives = 88/192 45%, Gaps = 19/192 9%
Query  1    VDYCKIKCLKG-GVHTAC-KYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
            +DYC + C  G G H  C   G S+  +CG    ++   T+  K+ IL   ND R+ VA+
Sbjct  24   LDYCSL-CRGGRGEHVGCGSPGFSS--DCGQKA-RTRKFTKEHKKVILDKINDVRDHVAK 79
Query  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKY-NVGQ-NIAV 116
            G  + G     P A  M  +VW+ ELA +A+     C      C+ T ++ + GQ N   
Sbjct  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEF 133
Query  117  -SSSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWA---KTKEIGCG 172
             +    +    +   +K    +  +    I  +       G+  ++  A   +   +GCG
Sbjct  134  YADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVGCG 193
Query  173  SIKYVDNNWYTHYLVCNYGPAGNFGNQEVYE 203
               +         L CN+    ++ N+ VY+
Sbjct  194  LTTWKLGGKARALLTCNFSSENDY-NRPVYK 223

Sequence Alignment: 42. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 40.0 bits 127,  Expect = 5e-05
 Identities = 37/103 35%, Positives = 54/103 52%, Gaps = 12/103 11%
Query  78   LVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSSTAAVYENVGNLVKAWENE 137
            L WN  LA  AQ +A + + G D   + +    G+N+A     +          K W  E
Sbjct  49   LKWNTTLAQYAQEYADK-RVG-DCAMEHSMGRWGENLASGDGMSGAAAT-----KYWVTE 101
Query  138  VKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNWYTHYLVCNYGP 192
             K+F    S  +    + GHY  +VW KT E+GCG I   +N    +Y+VC+Y P
Sbjct  102  -KEFYDEKS-NKCVKDECGHYLAVVWGKTTEVGCG-ISKCNNG--QNYVVCSYDP 151

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.