The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG
Sequence Info Allergen Name Length Opt Bits Score E Value
7065471 Pol m 5.0101 37 259 68.2 6.5e-15
P35780 Pol f 5 205 259 69.0 2.1e-14
P35759 Pol e 5.0101 205 244 65.3 2.7e-13
P83377 Pol g 5 206 244 65.3 2.7e-13
Q05109 Pol a 5 209 244 65.3 2.7e-13
AAT95009 Pol e 5.0101 226 241 64.6 4.7e-13
P81656 Pol d 5 206 240 64.4 5.3e-13
P35781 Vesp c 5 202 169 47.1 8.3e-08
P35782 Vesp c 5 202 169 47.1 8.3e-08
P0DMB9 Vesp v 5.0101 202 168 46.8 9.8e-08
P35786 Ves s 5 205 168 46.8 9.9e-08
Q7Z156 Poly s 5.0101 207 167 46.6 1.2e-07
C0HJV9 Poly p 5.0101 206 166 46.3 1.4e-07
P86686 Poly p 5.0102 207 163 45.6 2.3e-07
P81657 Vesp m 5 202 162 45.4 2.7e-07
AAA28302 Dol m 5.02 212 157 44.2 6.5e-07
P10737 Dol m 5.02 215 157 44.2 6.5e-07
P35787 Ves vi 5 206 155 43.7 8.9e-07
P10736 Dol m 5.0101 227 154 43.5 1.1e-06
Q05108 Dol a 5 203 144 41.0 5.6e-06
P35783 Ves f 5 204 139 39.8 1.3e-05
Q05110 Ves v 5 227 139 39.8 1.4e-05
P35785 Ves p 5 204 138 39.5 1.6e-05
P35760 Ves m 5 204 131 37.8 5.1e-05
P35784 Ves g 5 204 130 37.6 6e-05
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol m 5.0101 Sequence ID: 7065471

 Score = 68.2 bits 259,  Expect = 7e-15
 Identities = 37/37 100%, Positives = 37/37 100%, Gaps = 0/37 0%
Query  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG
Sbjct  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 2. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 69.0 bits 259,  Expect = 2e-14
 Identities = 37/37 100%, Positives = 37/37 100%, Gaps = 0/37 0%
Query  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG
Sbjct  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 3. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 65.3 bits 244,  Expect = 3e-13
 Identities = 35/37 94%, Positives = 35/37 94%, Gaps = 0/37 0%
Query  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            VDYCKIKC SGIHTVCQYGESTKPSKNCA KVIKSVG
Sbjct  1    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVG 37

Sequence Alignment: 4. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 65.3 bits 244,  Expect = 3e-13
 Identities = 34/36 94%, Positives = 35/36 97%, Gaps = 0/36 0%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            DYCKIKCSSG+HTVCQYGESTKPSKNCA KVIKSVG
Sbjct  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKVIKSVG 37

Sequence Alignment: 5. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 65.3 bits 244,  Expect = 3e-13
 Identities = 35/37 94%, Positives = 35/37 94%, Gaps = 0/37 0%
Query  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            VDYCKIKC SGIHTVCQYGESTKPSKNCA KVIKSVG
Sbjct  5    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVG 41

Sequence Alignment: 6. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 64.6 bits 241,  Expect = 5e-13
 Identities = 34/37 91%, Positives = 35/37 94%, Gaps = 0/37 0%
Query  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            VDYCKI+C SGIHTVCQYGESTKPSKNCA KVIKSVG
Sbjct  22   VDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVG 58

Sequence Alignment: 7. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 64.4 bits 240,  Expect = 5e-13
 Identities = 33/36 91%, Positives = 35/36 97%, Gaps = 0/36 0%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            DYCKIKCSSG+HTVCQYGESTKPSKNCA K+IKSVG
Sbjct  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVG 37

Sequence Alignment: 8. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 47.1 bits 169,  Expect = 8e-08
 Identities = 23/34 67%, Positives = 28/34 82%, Gaps = 2/34 5%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASG 35

Sequence Alignment: 9. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 47.1 bits 169,  Expect = 8e-08
 Identities = 23/34 67%, Positives = 28/34 82%, Gaps = 2/34 5%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASG 35

Sequence Alignment: 10. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 46.8 bits 168,  Expect = 1e-07
 Identities = 23/34 67%, Positives = 28/34 82%, Gaps = 2/34 5%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGRSVVKASG 35

Sequence Alignment: 11. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 46.8 bits 168,  Expect = 1e-07
 Identities = 24/35 68%, Positives = 28/35 80%, Gaps = 3/35 8%
Query  1    VDYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            VDYCKIKC   G+HT C+YG STKP  NC + V+KS G
Sbjct  1    VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYG 36

Sequence Alignment: 12. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 46.6 bits 167,  Expect = 1e-07
 Identities = 26/35 74%, Positives = 26/35 74%, Gaps = 1/35 2%
Query  3    YCKIKCSSGIHTVCQYGESTKPS-KNCADKVIKSVG 37
            YC IKCS   HTVCQYGESTKPS KNC    I SVG
Sbjct  3    YCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVG 38

Sequence Alignment: 13. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 46.3 bits 166,  Expect = 1e-07
 Identities = 24/35 68%, Positives = 24/35 68%, Gaps = 0/35 0%
Query  3    YCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            YC IKCS   HTVCQYGESTKPS  C    I SVG
Sbjct  3    YCNIKCSKVAHTVCQYGESTKPSSKCNKVSITSVG 37

Sequence Alignment: 14. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 45.6 bits 163,  Expect = 2e-07
 Identities = 26/35 74%, Positives = 26/35 74%, Gaps = 1/35 2%
Query  3    YCKIKCSSGIHTVCQYGESTKPS-KNCADKVIKSVG 37
            YC IKCS   HTVCQ GESTKPS KNCA   I SVG
Sbjct  3    YCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVG 38

Sequence Alignment: 15. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 45.4 bits 162,  Expect = 3e-07
 Identities = 22/34 64%, Positives = 28/34 82%, Gaps = 2/34 5%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKC SGIHT+C++G STKP  NC   V+K+ G
Sbjct  2    NYCKIKCRSGIHTLCKFGISTKP--NCGKNVVKASG 35

Sequence Alignment: 16. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 44.2 bits 157,  Expect = 6e-07
 Identities = 21/34 61%, Positives = 27/34 79%, Gaps = 2/34 5%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKCS GIHT+C++G S KP  NC  K++K  G
Sbjct  12   NYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHG 45

Sequence Alignment: 17. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 44.2 bits 157,  Expect = 7e-07
 Identities = 21/34 61%, Positives = 27/34 79%, Gaps = 2/34 5%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKCS GIHT+C++G S KP  NC  K++K  G
Sbjct  12   NYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHG 45

Sequence Alignment: 18. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 43.7 bits 155,  Expect = 9e-07
 Identities = 22/35 62%, Positives = 27/35 77%, Gaps = 3/35 8%
Query  1    VDYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            V+YCKIKC   G+HT C+YG STKP  NC   V+K+ G
Sbjct  2    VNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYG 37

Sequence Alignment: 19. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 43.5 bits 154,  Expect = 1e-06
 Identities = 20/34 58%, Positives = 26/34 76%, Gaps = 2/34 5%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKC  GIHT+C++G S KP  NC   V+K+ G
Sbjct  25   NYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYG 58

Sequence Alignment: 20. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 41.0 bits 144,  Expect = 6e-06
 Identities = 20/33 60%, Positives = 25/33 75%, Gaps = 3/33 9%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKI C  G HT+C+YG S KP  NC  K++KS G
Sbjct  2    NYCKI-CPKGTHTLCKYGTSMKP--NCGGKIVKSYG 34

Sequence Alignment: 21. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 39.8 bits 139,  Expect = 1e-05
 Identities = 21/33 63%, Positives = 26/33 78%, Gaps = 4/33 12%
Query  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKC   G+HT C+YG S KP  NC +KV+ S G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYG 35

Sequence Alignment: 22. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 39.8 bits 139,  Expect = 1e-05
 Identities = 21/33 63%, Positives = 26/33 78%, Gaps = 4/33 12%
Query  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKC   G+HT C+YG S KP  NC +KV+ S G
Sbjct  25   NYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYG 58

Sequence Alignment: 23. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 39.5 bits 138,  Expect = 2e-05
 Identities = 20/33 60%, Positives = 26/33 78%, Gaps = 4/33 12%
Query  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKC   G+HT C+YG S KP  NC +K++ S G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKIVVSYG 35

Sequence Alignment: 24. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 37.8 bits 131,  Expect = 5e-05
 Identities = 20/33 60%, Positives = 25/33 75%, Gaps = 4/33 12%
Query  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKC   G+HT C+YG S KP  NC +K + S G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYG 35

Sequence Alignment: 25. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 37.6 bits 130,  Expect = 6e-05
 Identities = 20/33 60%, Positives = 26/33 78%, Gaps = 4/33 12%
Query  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            +YCKIKC   G+HT C+Y ES KP  NCA+K + + G
Sbjct  2    NYCKIKCLKGGVHTACKY-ESLKP--NCANKKVVAYG 35

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.