The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG
LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG
GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN
MQHHYLICNYGPAGNYLGQLPYTKK
Sequence Info Allergen Name Length Opt Bits Score E Value
P35780 Pol f 5 205 1427 304.4 1.5e-84
Q05109 Pol a 5 209 1346 287.7 1.8e-79
P35759 Pol e 5.0101 205 1340 286.4 4.1e-79
AAT95009 Pol e 5.0101 226 1332 284.8 1.4e-78
P81656 Pol d 5 206 1237 265.1 1.1e-72
P83377 Pol g 5 206 1234 264.5 1.7e-72
C0HJV9 Poly p 5.0101 206 1130 242.9 5.2e-66
Q7Z156 Poly s 5.0101 207 1127 242.3 8e-66
P86686 Poly p 5.0102 207 1098 236.3 5.1e-64
P10737 Dol m 5.02 215 933 202.1 1e-53
AAA28302 Dol m 5.02 212 925 200.5 3.2e-53
Q05108 Dol a 5 203 911 197.5 2.3e-52
P35785 Ves p 5 204 892 193.6 3.6e-51
P0DMB9 Vesp v 5.0101 202 889 193.0 5.5e-51
P35786 Ves s 5 205 887 192.6 7.4e-51
Q05110 Ves v 5 227 886 192.4 9.2e-51
P35781 Vesp c 5 202 882 191.5 1.5e-50
P35783 Ves f 5 204 881 191.3 1.7e-50
P35760 Ves m 5 204 879 190.9 2.3e-50
P35787 Ves vi 5 206 876 190.3 3.6e-50
P10736 Dol m 5.0101 227 870 189.1 9.1e-50
P35782 Vesp c 5 202 868 188.6 1.1e-49
P35784 Ves g 5 204 865 188.0 1.7e-49
P81657 Vesp m 5 202 860 187.0 3.5e-49
P35779 Sol r 3 211 649 143.3 5.3e-36
P35778 Sol i 3 234 627 138.7 1.3e-34
C0ITL3 Pac c 3.0101 199 619 137.0 3.7e-34
QEA69430 Sco m 5.0101 210 337 78.6 1.5e-16
AAF65314 Cte f 2 264 325 76.2 1e-15
7065471 Pol m 5.0101 37 259 61.7 3.2e-12
ABC58726 Sol s 3.0101 90 263 62.9 3.4e-12
AAY32926 Sol g 3.0101 70 222 54.3 1e-09
AVD29827 Art si 2.0101 163 217 53.7 3.8e-09
AVD29822 Art an 2.0101 163 217 53.7 3.8e-09
AVD29825 Art gm 2.0101 163 217 53.7 3.8e-09
A0A2L1DGQ3 Art ar 2.0101 163 216 53.4 4.4e-09
AVD29826 Art la 2.0101 163 216 53.4 4.4e-09
AAU15051 Cyn d 24.0101 153 213 52.8 6.5e-09
AVD29824 Art ca 2.0101 163 211 52.4 9.1e-09
ADM18345 Tab y 5.0101 256 207 51.8 2.2e-08
XP_007199020 Pru p 9.0101 161 182 46.4 5.8e-07
AAF82096 Glo m 5 259 176 45.3 1.9e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 304.4 bits 1427,  Expect = 2e-84
 Identities = 205/205 100%, Positives = 205/205 100%, Gaps = 0/205 0%
Query  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
            VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG
Sbjct  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
Query  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
            LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG
Sbjct  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
Query  121  GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
            GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN
Sbjct  121  GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
Query  181  MQHHYLICNYGPAGNYLGQLPYTKK 205
            MQHHYLICNYGPAGNYLGQLPYTKK
Sbjct  181  MQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 2. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 287.7 bits 1346,  Expect = 2e-79
 Identities = 191/205 93%, Positives = 197/205 96%, Gaps = 0/205 0%
Query  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
            VDYCKIKC SGIHTVCQYGESTKPSKNCA KVIKSVGPTEEEKKLIV+EHNRFRQKVAQG
Sbjct  5    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 64
Query  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
            LETRGNPGPQPAASDMN+LVWNDELAHIAQVWASQCQ LVHDKCRNTAKY VGQNIAYAG
Sbjct  65   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 124
Query  121  GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
            GS LPDVVSLIKLWENEVKDFNYN GITKQNF K+GHYTQM+W KTKEIGCGSLKYM+NN
Sbjct  125  GSNLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENN 184
Query  181  MQHHYLICNYGPAGNYLGQLPYTKK 205
            MQ+HYLICNYGPAGNYLGQLPYTKK
Sbjct  185  MQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 3. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 286.4 bits 1340,  Expect = 4e-79
 Identities = 190/205 92%, Positives = 197/205 96%, Gaps = 0/205 0%
Query  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
            VDYCKIKC SGIHTVCQYGESTKPSKNCA KVIKSVGPTEEEKKLIV+EHNRFRQKVAQG
Sbjct  1    VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 60
Query  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
            LETRGNPGPQPAASDMN+LVWNDELAHIAQVWASQCQ LVHDKCRNTAKY VGQNIAYAG
Sbjct  61   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 120
Query  121  GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
            GSKLPDVVSLIKLWENEVKDFNYN GITKQNF K+GHYTQM+W KTKEIGCGSLKY++N 
Sbjct  121  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYIENK 180
Query  181  MQHHYLICNYGPAGNYLGQLPYTKK 205
            MQ+HYLICNYGPAGNYLGQLPYTKK
Sbjct  181  MQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 4. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 284.8 bits 1332,  Expect = 1e-78
 Identities = 189/205 92%, Positives = 196/205 95%, Gaps = 0/205 0%
Query  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
            VDYCKI+C SGIHTVCQYGESTKPSKNCA KVIKSVGPTEEEKKLIV+EHNRFRQKVAQG
Sbjct  22   VDYCKIRCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQG 81
Query  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
            LETRGNPGPQPAASDMN+LVWNDELAHIAQVWASQCQ LVHDKCRNTAKY VGQNIAYAG
Sbjct  82   LETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIAYAG 141
Query  121  GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
            GSKLPDVVSLIKLWENEVKDFNYN GITKQNF K+GHYTQM+W KTKEIGCGSLKYM+N 
Sbjct  142  GSKLPDVVSLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENK 201
Query  181  MQHHYLICNYGPAGNYLGQLPYTKK 205
            MQ+HYLICNYGPAGNYLGQLP TKK
Sbjct  202  MQNHYLICNYGPAGNYLGQLPNTKK 226

Sequence Alignment: 5. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 265.1 bits 1237,  Expect = 1e-72
 Identities = 176/204 86%, Positives = 187/204 91%, Gaps = 1/204 0%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            DYCKIKCSSG+HTVCQYGESTKPSKNCA K+IKSVGPTEEEKKLIV EHNRFRQKVA+GL
Sbjct  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKGL 61
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGG 121
            ETRGNPGPQPAAS+MNNLVWNDELA IAQVWASQCQILVHDKCRNT KYQVGQNIAYAG 
Sbjct  62   ETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
Query  122  SK-LPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
            S  +P V  LI+LWENEVKDFNYN GIT +NFGKVGHYTQM+W  TKE+GCGSLKY++ N
Sbjct  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
Query  181  MQHHYLICNYGPAGNYLGQLPYTKK 205
            MQ HYLICNYGPAGNYLGQ  YTKK
Sbjct  182  MQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 6. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 264.5 bits 1234,  Expect = 2e-72
 Identities = 176/204 86%, Positives = 186/204 91%, Gaps = 1/204 0%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            DYCKIKCSSG+HTVCQYGESTKPSKNCA KVIKSVGPTEEEKKLIV EHNRFRQKVAQGL
Sbjct  2    DYCKIKCSSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVAQGL 61
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGG 121
            ETRGNPGPQPAAS+MNNLVWNDE A IAQVWASQCQILVHDKCRNT KYQVGQNIAYAG 
Sbjct  62   ETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIAYAGS 121
Query  122  SK-LPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
            S  +P V  LI+LWENEVKDFNYN GIT +NFGKVGHYTQM+W  TKE+GCGSLKY++ N
Sbjct  122  SNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVEKN 181
Query  181  MQHHYLICNYGPAGNYLGQLPYTKK 205
            M+ HYLICNYGPAGNYLGQ  YTKK
Sbjct  182  MKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 7. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 242.9 bits 1130,  Expect = 5e-66
 Identities = 160/203 78%, Positives = 178/203 87%, Gaps = 1/203 0%
Query  3    YCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGLE 62
            YC IKCS   HTVCQYGESTKPS  C    I SVG TEEEKKLIV+EHNRFRQKVAQGLE
Sbjct  3    YCNIKCSKVAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGLE 62
Query  63   TRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAY-AGG 121
            TRGNPGPQPAASDMNNLVWNDELA+IAQVWASQCQ +VHDKCRNTA+YQVGQNIAY A  
Sbjct  63   TRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAST 122
Query  122  SKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNNM 181
            +  P +VSLI LWENEVKDFNY++GITK+NF KVGHYTQ++WAKTKE+GCGS+KY++  M
Sbjct  123  AAYPGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAKTKEVGCGSIKYIEKGM 182
Query  182  QHHYLICNYGPAGNYLGQLPYTKK 205
            + HYL+CNYGPAGNY+GQ  YTKK
Sbjct  183  KSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 8. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 242.3 bits 1127,  Expect = 8e-66
 Identities = 161/203 79%, Positives = 180/203 88%, Gaps = 2/203 0%
Query  3    YCKIKCSSGIHTVCQYGESTKPS-KNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            YC IKCS   HTVCQYGESTKPS KNC    I SVG TEEEKKLIV+EHNRFRQKVAQGL
Sbjct  3    YCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 62
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAY-AG 120
            ETRGNPGPQPAASDMNNLVWNDELA+IAQVWA+QCQ +VHDKCRNTA+YQVGQNIAY A 
Sbjct  63   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSAS 122
Query  121  GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
             +  P +VSLI LWENEVKDFNY++GITK+NF KVGHYTQ++WAKTKE+GCGS+KY++  
Sbjct  123  TAAYPGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKG 182
Query  181  MQHHYLICNYGPAGNYLGQLPYTKK 205
            M+ HYL+CNYGPAGNY+GQ  YTKK
Sbjct  183  MKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 9. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 236.3 bits 1098,  Expect = 5e-64
 Identities = 160/203 78%, Positives = 174/203 85%, Gaps = 2/203 0%
Query  3    YCKIKCSSGIHTVCQYGESTKPS-KNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            YC IKCS   HTVCQ GESTKPS KNCA   I SVG TEEEKKLIV+EHNRFRQKVAQGL
Sbjct  3    YCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 62
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAY-AG 120
            ETRGNPGPQPAASDMNNLVWNDELA+IAQVWASQCQ +VHDKCRNTA+YQVGQNIAY A 
Sbjct  63   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAS 122
Query  121  GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN 180
             +  P VV LI LWENEVKDFNYN GITK+NF KVGHYTQ++WAKTKE+GCGS+KY++  
Sbjct  123  TAAYPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKG 182
Query  181  MQHHYLICNYGPAGNYLGQLPYTKK 205
            M+ HYL+CNYGPAGN LG   Y  K
Sbjct  183  MKSHYLVCNYGPAGNVLGAQIYEIK 207

Sequence Alignment: 10. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 202.1 bits 933,  Expect = 1e-53
 Identities = 132/201 65%, Positives = 160/201 79%, Gaps = 6/201 2%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            +YCKIKCS GIHT+C++G S KP  NC  K++K  G + +EK  IVN HN+FRQKVA+GL
Sbjct  12   NYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGL 69
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG- 120
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC  + HD+CRNT KYQVGQN+A A  
Sbjct  70   ETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCS-FGHDQCRNTEKYQVGQNVAIAST 128
Query  121  -GSKLPDVVSLIKLWENEVKDFNYNKG-ITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMK 178
             G+    +  LI++WENEVKDFN  KG +   NF KVGHYTQM+W KTKEIGCGS+KY++
Sbjct  129  TGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIE 188
Query  179  NNMQHHYLICNYGPAGNYLGQLPYTKK 205
            NN + HYL+CNYGPAGNY+ Q  Y +K
Sbjct  189  NNWHTHYLVCNYGPAGNYMDQPIYERK 215

Sequence Alignment: 11. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 200.5 bits 925,  Expect = 3e-53
 Identities = 131/198 66%, Positives = 158/198 79%, Gaps = 6/198 3%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            +YCKIKCS GIHT+C++G S KP  NC  K++K  G + +EK  IVN HN+FRQKVA+GL
Sbjct  12   NYCKIKCSRGIHTLCKFGTSMKP--NCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGL 69
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG- 120
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC  + HD+CRNT KYQVGQN+A A  
Sbjct  70   ETRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCS-FGHDQCRNTEKYQVGQNVAIAST 128
Query  121  -GSKLPDVVSLIKLWENEVKDFNYNKG-ITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMK 178
             G+    +  LI++WENEVKDFN  KG +   NF KVGHYTQM+W KTKEIGCGS+KY++
Sbjct  129  TGNSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIE 188
Query  179  NNMQHHYLICNYGPAGNYLGQLPY 202
            NN + HYL+CNYGPAGNY+ Q  Y
Sbjct  189  NNWHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 12. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 197.5 bits 911,  Expect = 2e-52
 Identities = 129/200 64%, Positives = 155/200 77%, Gaps = 6/200 3%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            +YCKI C  G HT+C+YG S KP  NC  K++KS G T +EK  IV  HN FRQKVAQGL
Sbjct  2    NYCKI-CPKGTHTLCKYGTSMKP--NCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQGL 58
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG- 120
            ETRGNPGPQP A +MN LVWNDELA IAQ WA+QC  + HD+CRNTAKY VGQN+A A  
Sbjct  59   ETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCN-FGHDQCRNTAKYPVGQNVAIAST 117
Query  121  -GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKN 179
             G+    +  LIK+WE+EVKD+N +K +   NF KVGHYTQM+W KTKEIGCGS+KY++N
Sbjct  118  TGNSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSKVGHYTQMVWGKTKEIGCGSVKYIEN 177
Query  180  NMQHHYLICNYGPAGNYLGQLPYTKK 205
              + HYL+CNYGPAGNY+ Q  Y +K
Sbjct  178  KWHTHYLVCNYGPAGNYMNQPVYERK 203

Sequence Alignment: 13. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 193.6 bits 892,  Expect = 4e-51
 Identities = 123/200 61%, Positives = 158/200 79%, Gaps = 7/200 3%
Query  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
            +YCKIKC   G+HT C+YG S KP  NC +K++ S G T+EEK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKIVVSYGLTKEEKQDILKEHNDFRQKIARG 58
Query  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
            LETRGNPGPQP A +M NLVWNDELA++AQVWA+QCQ   HD CR+ AKY VGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYPVGQNVALTG 117
Query  121  GS--KLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMK 178
             +  K  + V L+K+WE+EVKD+N  K  ++ NF K+GHYTQM+WA TKEIGCGS+KY++
Sbjct  118  STADKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNKIGHYTQMVWANTKEIGCGSIKYIQ 177
Query  179  NNMQHHYLICNYGPAGNYLGQLPYTKK 205
            N  + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  NEWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 14. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 193.0 bits 889,  Expect = 5e-51
 Identities = 129/198 65%, Positives = 158/198 79%, Gaps = 9/198 4%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G T+ EK  I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGRSVVKASGLTKAEKLEILKQHNEFRQKVARGL 59
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG- 120
            ETRGNPGPQP A  MN LVWNDELA+IAQVWASQC+   HD CRNTAKY VGQNIA    
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYG-HDNCRNTAKYLVGQNIAEQST 118
Query  121  -GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKN 179
              + +  V +++K+W +EVKD+ Y  G +K  +  VGHYTQM+WAKTKEIGCG++KY++N
Sbjct  119  TAASFEPVSNMVKMWSDEVKDYQY--GSSKNKLNDVGHYTQMVWAKTKEIGCGNIKYIEN 176
Query  180  NMQHHYLICNYGPAGNYLGQLP-YTKK 205
              +HHYL+CNYGPAGN +G  P Y KK
Sbjct  177  GWHHHYLVCNYGPAGN-IGNEPIYEKK 202

Sequence Alignment: 15. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 192.6 bits 887,  Expect = 7e-51
 Identities = 127/202 62%, Positives = 155/202 76%, Gaps = 6/202 2%
Query  1    VDYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQ 59
            VDYCKIKC   G+HT C+YG STKP  NC + V+KS G T+ EK+ I+  HN FR KVA+
Sbjct  1    VDYCKIKCLKGGVHTACKYGTSTKP--NCGNMVVKSYGVTQAEKQEILKIHNDFRNKVAR 58
Query  60   GLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYA 119
            GLETRGNPGPQP A +MNNLVWN+ELA+IAQ+WASQC+   HD C++T KY VGQNIA +
Sbjct  59   GLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYG-HDTCKDTTKYNVGQNIAVS 117
Query  120  GGSK--LPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYM 177
              +     +V +L+K WENEVKDFN      +  F K+GHYTQM+WAKTKEIGCGS+KY+
Sbjct  118  SSTAAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYV 177
Query  178  KNNMQHHYLICNYGPAGNYLGQLPYTKK 205
             NN   HYL+CNYGPAGN+  Q  Y +K
Sbjct  178  DNNWYTHYLVCNYGPAGNFGNQEVYERK 205

Sequence Alignment: 16. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 192.4 bits 886,  Expect = 9e-51
 Identities = 122/200 61%, Positives = 157/200 78%, Gaps = 7/200 3%
Query  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
            +YCKIKC   G+HT C+YG S KP  NC +KV+ S G T++EK+ I+ EHN FRQK+A+G
Sbjct  25   NYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARG 81
Query  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
            LETRGNPGPQP A +M NLVWNDELA++AQVWA+QCQ   HD CR+ AKYQVGQN+A  G
Sbjct  82   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 140
Query  121  GS--KLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMK 178
             +  K  D V L+K+WE+EVKD+N  K  +  +F K GHYTQM+WA TKE+GCGS+KY++
Sbjct  141  STAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYIQ 200
Query  179  NNMQHHYLICNYGPAGNYLGQLPYTKK 205
               + HYL+CNYGP+GN++ +  Y  K
Sbjct  201  EKWHKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 17. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 191.5 bits 882,  Expect = 1e-50
 Identities = 130/196 66%, Positives = 158/196 80%, Gaps = 13/196 6%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G T++E   I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQHNEFRQKVARGL 59
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGG 121
            ETRGNPGPQP A  MN LVWNDELA+IAQVWA+QC    HD CRN+AKY VGQNIA   G
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-HDNCRNSAKYSVGQNIAE--G 116
Query  122  SKLPD----VVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYM 177
            S   D    V +++K+WE+EVKD+ Y  G  K  + KVGHYTQM+WAKTKEIGCGS+KY+
Sbjct  117  STTADNFGSVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSIKYI 174
Query  178  KNNMQHHYLICNYGPAGNYLGQLP-YTKK 205
            +N  + HYL+CNYGPAGN +G  P Y +K
Sbjct  175  ENGWHRHYLVCNYGPAGN-VGNEPIYERK 202

Sequence Alignment: 18. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 191.3 bits 881,  Expect = 2e-50
 Identities = 122/200 61%, Positives = 156/200 78%, Gaps = 7/200 3%
Query  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
            +YCKIKC   G+HT C+YG S KP  NC +KV+ S G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARG 58
Query  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
            LETRGNPGPQP A +M NLVWNDELA++AQVWA+QCQ   HD CR+ AKYQVGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYG-HDTCRDIAKYQVGQNVALTG 117
Query  121  GS--KLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMK 178
             +  K  D V L+K+WE+EVKD+N  K  +  NF K GHYTQM+WA TKE+GCGS+K+++
Sbjct  118  STAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLKTGHYTQMVWANTKEVGCGSIKFIQ 177
Query  179  NNMQHHYLICNYGPAGNYLGQLPYTKK 205
               + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  EKWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 19. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 190.9 bits 879,  Expect = 2e-50
 Identities = 122/200 61%, Positives = 157/200 78%, Gaps = 7/200 3%
Query  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
            +YCKIKC   G+HT C+YG S KP  NC +K + S G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKP--NCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARG 58
Query  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
            LETRGNPGPQP A +M NLVW+DELA+IAQVWA+QCQ   HD CR+ AKYQVGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYQVGQNVALTG 117
Query  121  GSK--LPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMK 178
             +     D V L+K+WE+EVKD+N  K  ++ NF K+GHYTQM+WA TKE+GCGS+KY++
Sbjct  118  STAAVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
Query  179  NNMQHHYLICNYGPAGNYLGQLPYTKK 205
             N + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  ENWHKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 20. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 190.3 bits 876,  Expect = 4e-50
 Identities = 130/202 64%, Positives = 156/202 77%, Gaps = 6/202 2%
Query  1    VDYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQ 59
            V+YCKIKC   G+HT C+YG STKP  NC   V+K+ G TE EK+ I+  HN FRQKVA+
Sbjct  2    VNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
Query  60   GLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIA-Y 118
            GLETRGNPGPQP A +MNNLVWNDELA+IAQVWASQC    HD C++T KY VGQNIA  
Sbjct  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKR 118
Query  119  AGGSKLPDVVS-LIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYM 177
            +  + L D    L+K+WENEVKDFN N   +K N+ K GHYTQM+WAKTKEIGCGS+KY+
Sbjct  119  STTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYV 178
Query  178  KNNMQHHYLICNYGPAGNYLGQLPYTKK 205
            K+    HYL+CNYGP+GN+  +  Y KK
Sbjct  179  KDEWYTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 21. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 189.1 bits 870,  Expect = 9e-50
 Identities = 123/201 61%, Positives = 150/201 74%, Gaps = 5/201 2%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            +YCKIKC  GIHT+C++G S KP  NC   V+K+ G T +EK  I+  HN FRQ VA+GL
Sbjct  25   NYCKIKCRKGIHTLCKFGTSMKP--NCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGL 82
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG- 120
            ETRG PGPQP A +MN LVWNDELA IAQ WA+QC  + HD CRNTAKYQVGQNIA +  
Sbjct  83   ETRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCD-FNHDDCRNTAKYQVGQNIAISST 141
Query  121  -GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKN 179
              +++     LIK WE+EV +FNY  G+   NF KVGHYTQM+W KTKEIGCGS+KY+++
Sbjct  142  TATQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIED 201
Query  180  NMQHHYLICNYGPAGNYLGQLPYTKK 205
            N   HYL+CNYGP GN + Q  Y +K
Sbjct  202  NWYTHYLVCNYGPGGNDFNQPIYERK 227

Sequence Alignment: 22. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 188.6 bits 868,  Expect = 1e-49
 Identities = 126/198 63%, Positives = 156/198 78%, Gaps = 9/198 4%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            +YCKIKC SGIHT+C+YG STKP  NC   V+K+ G T++E   I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKYGTSTKP--NCGKNVVKASGLTKQENLEILKQHNEFRQKVARGL 59
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGG 121
            ETRGNPGPQP A  MN LVWNDELA+IAQVWA+QC    HD CRN+AKY VGQNIA    
Sbjct  60   ETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYG-HDNCRNSAKYSVGQNIAEGST 118
Query  122  S--KLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKN 179
            S   + +V +++K+WE+EVKD+ Y  G  K  + KVGHYTQM+WAKTKEIGCGS  Y+++
Sbjct  119  SADNFVNVSNMVKMWEDEVKDYQY--GSPKNKLNKVGHYTQMVWAKTKEIGCGSEDYIED 176
Query  180  NMQHHYLICNYGPAGNYLGQLP-YTKK 205
              + HYL+CNYGPAGN +G  P Y +K
Sbjct  177  GWHRHYLVCNYGPAGN-VGNEPIYERK 202

Sequence Alignment: 23. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 188.0 bits 865,  Expect = 2e-49
 Identities = 120/200 60%, Positives = 158/200 79%, Gaps = 7/200 3%
Query  2    DYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG 60
            +YCKIKC   G+HT C+Y ES KP  NCA+K + + G T++EK+ I+ EHN FRQK+A+G
Sbjct  2    NYCKIKCLKGGVHTACKY-ESLKP--NCANKKVVAYGLTKQEKQDILKEHNDFRQKIARG 58
Query  61   LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG 120
            LETRGNPGPQP A +M NLVW+DELA+IAQVWA+QCQ   HD CR+ AKY VGQN+A  G
Sbjct  59   LETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYG-HDTCRDVAKYPVGQNVALTG 117
Query  121  GS--KLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMK 178
             +  K  + V L+K+WE+EVKD+N  K  ++ NF K+GHYTQM+WA TKE+GCGS+KY++
Sbjct  118  STAAKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQ 177
Query  179  NNMQHHYLICNYGPAGNYLGQLPYTKK 205
            +  + HYL+CNYGP+GN+  +  Y  K
Sbjct  178  DKWHKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 24. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 187.0 bits 860,  Expect = 4e-49
 Identities = 125/198 63%, Positives = 156/198 78%, Gaps = 9/198 4%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            +YCKIKC SGIHT+C++G STKP  NC   V+K+ G T+ EK  I+ +HN FRQKVA+GL
Sbjct  2    NYCKIKCRSGIHTLCKFGISTKP--NCGKNVVKASGLTKAEKLEILKQHNEFRQKVARGL 59
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGG 121
            ETRG PGPQP A  MN LVWNDELA+IAQVWA QC    HD CRNTAKY VGQNIA  G 
Sbjct  60   ETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYG-HDVCRNTAKYSVGQNIAENGS 118
Query  122  S--KLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKN 179
            +   +  V +++++W +EVK++ Y  G TK  + +VGHYTQM+WAKTKEIGCGS+KY++N
Sbjct  119  TAASFASVSNMVQMWADEVKNYQY--GSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIEN 176
Query  180  NMQHHYLICNYGPAGNYLGQLP-YTKK 205
              + HYL+CNYGPAGN +G  P Y +K
Sbjct  177  GWHRHYLVCNYGPAGN-IGNEPIYERK 202

Sequence Alignment: 25. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 143.3 bits 649,  Expect = 5e-36
 Identities = 103/199 51%, Positives = 135/199 67%, Gaps = 15/199 7%
Query  2    DYCKIK-C--SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVA 58
            +YC ++ C  ++ IHT+CQY  S  P   C +    +VG T+ EK  IVN+HN +RQ+VA
Sbjct  2    NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 58
Query  59   QGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAY 118
             G E RG  GPQP A  M NL W+ ELA IAQ WA+QC  + HD CRN  ++ VGQNIA 
Sbjct  59   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCT-FEHDACRNVERFAVGQNIAA 117
Query  119  --AGGSKLPDVVSLIKLWENEVKDFNYNKGITK-----QNFGKVGHYTQMIWAKTKEIGC 171
              + G     +  +I LW NEVKDF+ N+ I+        +  VGHYTQ++WAKTK+IGC
Sbjct  118  TSSSGKNKSTLSDMILLWYNEVKDFD-NRWISSFPSDGNILMHVGHYTQIVWAKTKKIGC 176
Query  172  GSLKYMKNNMQHHYLICNYGPAGNYLGQLPYTKK 205
            G + + ++N   HYL+CNYGPAGN LG   Y  K
Sbjct  177  GRIMFKEDNWNKHYLVCNYGPAGNVLGAQIYEIK 210

Sequence Alignment: 26. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 138.7 bits 627,  Expect = 1e-34
 Identities = 105/197 53%, Positives = 136/197 69%, Gaps = 20/197 10%
Query  2    DYCKIK-C--SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVA 58
            +YC ++ C  ++ IHT+CQY  S  P   C +    +VG T+ EK  IVN+HN +RQ+VA
Sbjct  24   NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 80
Query  59   QGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAY 118
             G E RG  GPQP A  M NL W+ ELA IAQ WA+QC  + HD CRN  ++ VGQNIA 
Sbjct  81   SGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCT-FEHDACRNVERFAVGQNIAA 139
Query  119  AGGS----KLPDVVSLIKLWENEVKDFNYNKGITK----QN-FGKVGHYTQMIWAKTKEI 169
               S      P+   +I LW NEVKDF+ N+ I+      N + KVGHYTQ++WAKT +I
Sbjct  140  TSSSGKNKSTPN--EMILLWYNEVKDFD-NRWISSFPSDDNILMKVGHYTQIVWAKTTKI 196
Query  170  GCGSLKYMK-NNMQHHYLICNYGPAGNYLGQLPYTKK 205
            GCG + + + +N   HYL+CNYGPAGN LG   Y  K
Sbjct  197  GCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233

Sequence Alignment: 27. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 137.0 bits 619,  Expect = 4e-34
 Identities = 93/183 50%, Positives = 128/183 69%, Gaps = 10/183 5%
Query  12   IHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGLETRGNPGPQP 71
            +HT+CQY  S +PS NC      +   T  +K+ I+  HN  RQKV  G ETRGNPGPQP
Sbjct  6    VHTMCQY-TSPQPSPNCG--TYSNAHITAADKETILKVHNDERQKVKAGQETRGNPGPQP 62
Query  72   AASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGGS-KLP-DVVS 129
            AAS+M +L W++ELA IAQ W +QC+I  HD CRN  +YQVGQNIA +G + K P ++ +
Sbjct  63   AASNMPDLTWDNELAAIAQRWVNQCKIG-HDGCRNVERYQVGQNIAMSGSTAKGPCNMNN 121
Query  130  LIKLWENEVKDFN---YNKGITKQN-FGKVGHYTQMIWAKTKEIGCGSLKYMKNNMQHHY 185
            L+++W NEV  +N    +   +  N F K+GHYTQ++W KT ++GCG ++++       Y
Sbjct  122  LVQMWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCY 181
Query  186  LICNYGPAGNYLG 198
            L CNYGPAGN +G
Sbjct  182  LACNYGPAGNMFG 194

Sequence Alignment: 28. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 78.6 bits 337,  Expect = 2e-16
 Identities = 67/160 41%, Positives = 100/160 62%, Gaps = 18/160 11%
Query  33   IKSVGPTEEEKKLIVNEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVW 92
            +K  G     KK+I++ HN+ RQ VA G ++ G    QP+A++M  L W+D++A  AQ  
Sbjct  26   MKVRGLDANMKKMILDLHNKKRQTVANGQQS-G----QPSAANMKELHWDDQIAANAQRS 80
Query  93   ASQCQILVHD--KCRNTAKYQ-VGQNIAYAGGSKLPDVVSL-IKLWENEVKDFNYNKGIT 148
            A  C ++ H     R T+KY  +G+NI Y G    PD +   +  W +EVKD       +
Sbjct  81   AETC-VFQHTAKNLRKTSKYSYLGENI-YMGS--YPDPIPRSVNAWYDEVKDVTPAVVKS 136
Query  149  KQNFGK-VGHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPYTKK 205
             ++ G  +GHYTQM+WA T+ +GCG +     N    Y+ C YGP+GNY G+ P  K+
Sbjct  137  FRSGGPMIGHYTQMVWANTEALGCGLVTASDKNT---YIFCQYGPSGNYPGE-PIYKQ 190

Sequence Alignment: 29. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 76.2 bits 325,  Expect = 1e-15
 Identities = 79/194 40%, Positives = 108/194 55%, Gaps = 25/194 12%
Query  2    DYCKIKCSSGIHTVCQYGESTKPS--KNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQ 59
            DYC + C++G +  C     TKP   ++C +   K V  TE  KK  +N HNR R+ VA 
Sbjct  33   DYCNLNCTNGPNVGC-----TKPDVPRDCQN--FKLVNITERMKKAFLNAHNRKRRLVAA 85
Query  60   GLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYA 119
            G     +    P A+ M NL WN  LA +A+    QC+ + HD C  T   + GQN+ + 
Sbjct  86   GKGLLKDGVHTPIAAKMPNLTWNIALAKLAEYNVKQCE-MKHD-CAKTRHGHTGQNLFFY 143
Query  120  GGSKLPDVVSLI-KL----WENEVKDF---NYNKGITKQNFGK-VGHYTQMIWAKTKEIG 170
            G +  P   S I K+    W  E KD    +  K  T    GK +GHYTQ+IW  T ++G
Sbjct  144  GTTLSPIKNSTIAKMAVDGWYAESKDTRLEDIKKLTTIYPNGKPIGHYTQLIWGNTTKVG 203
Query  171  CGSLKYMKN---NMQHHYLI-CNYGPAGNYLGQLPYTKK 205
            C    Y K+   NM +  L+ CNY   GN L +  Y  K
Sbjct  204  CAVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIK 241

Sequence Alignment: 30. Allergen Name: Pol m 5.0101 Sequence ID: 7065471

 Score = 61.7 bits 259,  Expect = 3e-12
 Identities = 37/37 100%, Positives = 37/37 100%, Gaps = 0/37 0%
Query  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37
            VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG
Sbjct  1    VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 31. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 62.9 bits 263,  Expect = 3e-12
 Identities = 44/86 51%, Positives = 57/86 66%, Gaps = 6/86 6%
Query  2    DYCKIK-C--SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVA 58
            +YC ++ C  ++ IHT+CQY  S  P   C +    +VG T+ EK  IVN+HN +RQ+VA
Sbjct  2    NYCNLQSCKRNNAIHTMCQY-TSPTPGPMCLE--YSNVGFTDAEKDAIVNKHNELRQRVA 58
Query  59   QGLETRGNPGPQPAASDMNNLVWNDELAHIAQ 90
             G E RG   PQP A  M NL W+ ELA IAQ
Sbjct  59   SGKEMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

Sequence Alignment: 32. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 54.3 bits 222,  Expect = 1e-09
 Identities = 30/52 57%, Positives = 39/52 75%, Gaps = 1/52 1%
Query  154  KVGHYTQMIWAKTKEIGCGSLKYMK-NNMQHHYLICNYGPAGNYLGQLPYTKK 205
            K+GHYTQ++WAKT +IGCG + + + +N   HYL+CNYGPAGN LG   Y  K
Sbjct  17   KIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69

Sequence Alignment: 33. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 53.7 bits 217,  Expect = 4e-09
 Identities = 51/123 41%, Positives = 81/123 65%, Gaps = 34/123 27%
Query  62   ETRGNPGPQPA----ASD-------MNNLVWNDELAHIAQVWA----SQCQILVHDKC-R 105
            ET G PG  P     A +       M  L W+DELA +AQ WA    + C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAEARTADCSLVHSDRCGE 84
Query  106  NTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAK 165
            N A+  +  ++A             ++LW +E  D++YN+    +     GHYTQ++WA 
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPY 202
            ++ +GCG  + + +N   + ++CNY P GN +GQ PY
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 34. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 53.7 bits 217,  Expect = 4e-09
 Identities = 52/123 42%, Positives = 79/123 64%, Gaps = 34/123 27%
Query  62   ETRGNPGPQPA----ASD-------MNNLVWNDELAHIAQVWAS----QCQILVHDKC-R 105
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRCGE 84
Query  106  NTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAK 165
            N A+  +  ++A             ++LW +E  D++YN+    +     GHYTQ++WA 
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPY 202
            T+ +GCG  + + +N   +  +CNY P GN +GQ PY
Sbjct  129  TERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 35. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 53.7 bits 217,  Expect = 4e-09
 Identities = 52/123 42%, Positives = 79/123 64%, Gaps = 34/123 27%
Query  62   ETRGNPGPQPA----ASD-------MNNLVWNDELAHIAQVWAS----QCQILVHDKC-R 105
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRCGE 84
Query  106  NTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAK 165
            N A+  +  ++A             ++LW +E  D++YN+    +     GHYTQ++WA 
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPY 202
            T+ +GCG  + + +N   +  +CNY P GN +GQ PY
Sbjct  129  TERVGCG--RALCSNGWAYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 36. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 53.4 bits 216,  Expect = 4e-09
 Identities = 51/123 41%, Positives = 80/123 65%, Gaps = 34/123 27%
Query  62   ETRGNPGPQPA----ASD-------MNNLVWNDELAHIAQVWAS----QCQILVHDKC-R 105
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
Query  106  NTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAK 165
            N A+  +  ++A             ++LW +E  D++YN+    +     GHYTQ++WA 
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPY 202
            ++ +GCG  + + +N   + ++CNY P GN +GQ PY
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 37. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 53.4 bits 216,  Expect = 4e-09
 Identities = 51/123 41%, Positives = 80/123 65%, Gaps = 34/123 27%
Query  62   ETRGNPGPQPA----ASD-------MNNLVWNDELAHIAQVWAS----QCQILVHDKC-R 105
            ET G PG  P     A +       M  L W+DELA +AQ WA      C ++  D+C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGE 84
Query  106  NTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAK 165
            N A+  +  ++A             ++LW +E  D++YN+    +     GHYTQ++WA 
Sbjct  85   NMAQGAINGSMA-------------VQLWLDERLDYDYNE---NKCIKMCGHYTQIVWAN 128
Query  166  TKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPY 202
            ++ +GCG  + + +N   + ++CNY P GN +GQ PY
Sbjct  129  SERVGCG--RALCSNGWAYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 38. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 52.8 bits 213,  Expect = 7e-09
 Identities = 47/140 33%, Positives = 77/140 55%, Gaps = 28/140 20%
Query  37   GPTEEEKKLIVNEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQC 96
            G  ++  + I+NEHN FR K                   +  L WN  LA  +Q +A   
Sbjct  12   GLNDKAIQDILNEHNMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK 54
Query  97   QILVHDKCRNT-AKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKV 155
              L  D C+   +    G+N+ +  G+      + +  W +E K ++Y      Q  GK+
Sbjct  55   --LKKD-CKMVHSDSPYGENLMFGSGA--ISWKTTVDTWSDEKKSYHYGSNTCDQ--GKM 107
Query  156  -GHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPY 202
             GHYT ++W  T  +GCG  + + ++ +   ++C+Y P GNY  Q PY
Sbjct  108  CGHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYENQKPY 153

Sequence Alignment: 39. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 52.4 bits 211,  Expect = 9e-09
 Identities = 44/109 40%, Positives = 72/109 66%, Gaps = 23/109 21%
Query  76   MNNLVWNDELAHIAQVWAS----QCQILVHDKC-RNTAKYQVGQNIAYAGGSKLPDVVSL 130
            M  L W+DELA +AQ WA      C ++  D+C  N A+  +  ++A             
Sbjct  50   MKPLCWDDELAKVAQAWAETRTPDCSLIHSDRCGENMAQGAINGSMA------------- 96
Query  131  IKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNY 190
            ++LW +E  D++YN+    +     GHYTQ++WA ++ +GCG  + + +N   + ++CNY
Sbjct  97   VQLWLDERLDYDYNEN---KCIKMCGHYTQIVWANSERVGCG--RALCSNGWAYIIVCNY 151
Query  191  GPAGNYLGQLPY 202
             P GN +GQ PY
Sbjct  152  DPPGNVVGQKPY 163

Sequence Alignment: 40. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 51.8 bits 207,  Expect = 2e-08
 Identities = 58/184 31%, Positives = 95/184 51%, Gaps = 22/184 11%
Query  1    VDYCKI-KCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQ 59
            +DYC + +   G H  C  G S   S +C  K  ++   T+E KK+I+++ N  R  VA+
Sbjct  24   LDYCSLCRGGRGEHVGC--G-SPGFSSDCGQKA-RTRKFTKEHKKVILDKINDVRDHVAK 79
Query  60   GLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQV-GQ-NIA 117
            G  + G     P AS M  +VW++ELA +A+     C    + KCR+T ++   GQ N  
Sbjct  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAY-KCRHTLRFWSPGQLNFE 132
Query  118  YAGGSKLPDVVSLIK--LWENEVKDFNYNKGITK--QNFGKVGHYTQMIWA---KTKEIG 170
            +    K+P  +SLI   +     +  N  + I +  Q  G  G+  ++  A   +   +G
Sbjct  133  FYA-DKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKELALAISDRVTAVG 191
Query  171  CGSLKYMKNNMQHHYLICNYGPAGNY 196
            CG   +         L CN+    +Y
Sbjct  192  CGLTTWKLGGKARALLTCNFSSENDY 217

Sequence Alignment: 41. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 46.4 bits 182,  Expect = 6e-07
 Identities = 50/140 35%, Positives = 78/140 55%, Gaps = 28/140 20%
Query  35   SVGPTEEEKKLIVNEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWAS 94
            S   ++EE    V EHN+ R++V          G +P       L WN  LA+ AQ +A 
Sbjct  22   SANISKEEIDGFVEEHNKARKEV----------GNKP-------LKWNTTLAQYAQEYAD 64
Query  95   QCQILVHDKCRNTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGK 154
            +    V D     +  + G+N+  A G  +    +  K W  E K+F Y++   K    +
Sbjct  65   K---RVGDCAMEHSMGRWGENL--ASGDGMSGAAAT-KYWVTE-KEF-YDEKSNKCVKDE 116
Query  155  VGHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPY 202
             GHY  ++W KT E+GCG     K N  ++Y++C+Y P      + PY
Sbjct  117  CGHYLAVVWGKTTEVGCG---ISKCNNGQNYVVCSYDPMYQPEDERPY 161

Sequence Alignment: 42. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 45.3 bits 176,  Expect = 2e-06
 Identities = 66/188 35%, Positives = 101/188 53%, Gaps = 26/188 13%
Query  2    DYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGL 61
            DYC + C +  H  C      +       K+I       + +  +++ HN+ R  VA G 
Sbjct  21   DYCGL-CDN--HDACVMQNVFQSGCPSGAKMID----LNKYQSALLDAHNKKRNHVAGGG 73
Query  62   ETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQ-VGQNIAYAG 120
            E++        A  M  + W+ ELA +A+    QCQ + HD+CRNT K++  GQN+A  G
Sbjct  74   ESK-----LKRACQMATMKWDSELAKLAEYNVKQCQ-MNHDRCRNTVKFKYAGQNLAELG 127
Query  121  --GSKLPDVVSLIKL----WENEVKDFN--YNKGITKQNFGK-VGHYTQMIWAKTKEIGC 171
              G   PD   LI+     W  EVKD N  Y         G  +GH+T M+  +   +GC
Sbjct  128  RSGGPPPDYRKLIEKAVDKWYEEVKDCNQGYIDSYPMNYRGPAIGHFTVMVAERNTHVGC 187
Query  172  GSLKYMKNN-MQHHYLICNYGPAGNYLGQLPYTK 204
             + +Y K+N  Q+  + CNY  A   + ++P  K
Sbjct  188  AASEYTKSNGFQYFLMACNY--ATTNMMEFPIYK 219

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.