The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS
GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF
GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD
VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK
ADTAYEAK
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA93121 Hol l 1.0102 248 1754 343.6 3.7e-96
P43216 Hol l 1 265 1751 343.0 6e-96
CAB63699 Lol p 1.0103 263 1661 325.8 8.7e-91
P43213 Phl p 1 263 1657 325.1 1.5e-90
CAA10140 Hol l 1 263 1653 324.3 2.5e-90
AAA63278 Lol p 1.0102 252 1650 323.8 3.5e-90
CAA10520 Poa p a 263 1643 322.4 9.4e-90
Q41260 Pha a 1 269 1639 321.6 1.6e-89
P14946 Lol p 1 263 1633 320.5 3.5e-89
AAA63279 Lol p 1.0101 263 1627 319.3 7.8e-89
CAA81613 Phl p 1.0101 263 1602 314.6 2.1e-87
AAF72983 Ory s 1 267 1291 255.3 1.6e-69
AAF72991 Ory s 1 267 1253 248.0 2.4e-67
A0A4D6FZ45 Uro m 1.0101 262 1213 240.4 4.6e-65
AAL14077 Cyn d 1.0202 262 1213 240.4 4.6e-65
AAL14079 Cyn d 1.0203 262 1213 240.4 4.6e-65
AAL14078 Cyn d 1 262 1207 239.2 1e-64
AAK96255 Cyn d 1.0201 244 1202 238.3 1.8e-64
AAF80379 Cyn d 1.0204 244 1199 237.7 2.7e-64
ABC58726 Sor h 1.0101 239 1186 235.3 1.4e-63
A0A4D6G2J8 Uro m 1.0201 229 1184 234.9 1.8e-63
O04701 Cyn d 1 246 1156 229.5 7.9e-62
ACA23876 Pas n 1.0101 265 1146 227.6 3.3e-61
QCX36431 Zoy m 1.0101 272 1141 226.6 6.6e-61
Q40638 Ory s 1 263 1129 224.4 3.1e-60
P58738 Zea m 1 269 1116 221.9 1.8e-59
AAF72990 Ory s 1 269 1092 217.3 4.2e-58
AAF72984 Ory s 1 268 938 187.9 2.9e-49
AAF72987 Ory s 1 275 929 186.2 9.9e-49
AAF72985 Ory s 1 286 903 181.2 3.2e-47
AAB61710 Ory s 1 261 882 177.3 4.6e-46
AAD10496 Tri a ps93 271 872 175.3 1.8e-45
AAF72989 Ory s 1 271 872 175.3 1.8e-45
Q07154 Zea m 1 191 823 166.1 7.5e-43
AAF72988 Ory s 1 327 758 153.5 8.2e-39
AAA50175 Gly m 2 277 722 146.7 7.7e-37
AAF72986 Ory s 1 275 710 144.4 3.7e-36
CAB37496 Ara t expansin 265 423 89.7 1.1e-19
BAA85432 Ory s 1 284 375 80.5 6.7e-17
AAG13596 Ory s 1 275 374 80.3 7.3e-17
CAA10346 Cyn d 2 122 267 60.3 3.5e-11
CAA10345 Dac g 2 122 267 60.3 3.5e-11
CAA10348 Poa p 2 122 267 60.3 3.5e-11
P43214 Phl p 2 122 267 60.3 3.5e-11
Q7M1X8 Dac g 1.0101 34 237 55.1 3.5e-10
P14947 Lol p 2 97 239 55.0 1.1e-09
Q7M1X6 Ant o 1.0101 32 225 52.8 1.6e-09
P93124 Dac g 3 96 229 53.1 3.9e-09
CAA51775 Lol p 2 88 224 52.2 6.8e-09
AAP80171 Cyn d 15 112 216 50.6 2.7e-08
2JNZ_A Phl p 3.0101 108 207 48.9 8.4e-08
P14948 Lol p 3 97 189 45.5 7.9e-07
CAA90746 Tri a 3 118 169 41.6 1.4e-05
A0A077B7S9 Sor h 2.0101 119 135 35.1 0.0013
A0A077B2S0 Sor h 2.0201 121 130 34.1 0.0026
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 343.6 bits 1754,  Expect = 4e-96
 Identities = 248/248 100%, Positives = 248/248 100%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS
Sbjct  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF
Sbjct  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD
Sbjct  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK
Sbjct  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
Query  241  ADTAYEAK 248
            ADTAYEAK
Sbjct  241  ADTAYEAK 248

Sequence Alignment: 2. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 343.0 bits 1751,  Expect = 6e-96
 Identities = 247/248 99%, Positives = 248/248 100%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS
Sbjct  18   VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 77
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFKDGRGCGSCFEIKC+KPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF
Sbjct  78   GMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 137
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD
Sbjct  138  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 197
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK
Sbjct  198  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 257
Query  241  ADTAYEAK 248
            ADTAYEAK
Sbjct  258  ADTAYEAK 265

Sequence Alignment: 3. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 325.8 bits 1661,  Expect = 9e-91
 Identities = 232/248 93%, Positives = 240/248 96%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VFLGSAHGIAKVPPGPNITA YGD+WLDAKSTWYGKPTGAGPKDNGGACGYKDVDK PF+
Sbjct  16   VFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFN 75
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFKDGRGCGSCFEIKC+KPESCSGE VTV ITDDNEEPIAPYHFDLSGHAF
Sbjct  76   GMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 135
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            GSMAKKGEEQKLRSAGELEL+FRRVKCKYPDGTKPTFHVEK SNPNYLA+LVKY+DGDGD
Sbjct  136  GSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGD 195
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKWIELKESWGAVWR+DTPDKLTGPFTVRYTTEGGTK E EDVIPEGWK
Sbjct  196  VVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWK 255
Query  241  ADTAYEAK 248
            ADT+Y AK
Sbjct  256  ADTSYSAK 263

Sequence Alignment: 4. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 325.1 bits 1657,  Expect = 1e-90
 Identities = 229/248 92%, Positives = 243/248 97%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VFLGSA+GI KVPPGPNITATYGD+WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS
Sbjct  16   VFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 75
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFK GRGCGSCFEIKC+KPE+CSGEPV VHITDDNEEPIAPYHFDLSGHAF
Sbjct  76   GMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAF 135
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            G+MAKKG+EQKLRSAGELEL+FRRVKCKYP+GTK TFHVEKGSNPNYLALLVKY++GDGD
Sbjct  136  GAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGD 195
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKWIELKESWGA+WR+DTPDKLTGPFTVRYTTEGGTK EAEDVIPEGWK
Sbjct  196  VVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWK 255
Query  241  ADTAYEAK 248
            ADT+YE+K
Sbjct  256  ADTSYESK 263

Sequence Alignment: 5. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 324.3 bits 1653,  Expect = 3e-90
 Identities = 232/248 93%, Positives = 241/248 97%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VFLG+AHGIAKVPPGPNITATYGD+WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS
Sbjct  16   VFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 75
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFK GRGCGSCFEIKC+KPESCSGEP+ VHITDDNEEPIA YH+DLSG AF
Sbjct  76   GMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAF 135
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            G+MAKKGEEQKLRSAGELELKFRRVKC+YP GTK TFHVEKGSNPNYLALLVKY+DGDGD
Sbjct  136  GAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGD 195
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTK EAEDVIPEGWK
Sbjct  196  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVIPEGWK 255
Query  241  ADTAYEAK 248
            ADTAYE+K
Sbjct  256  ADTAYESK 263

Sequence Alignment: 6. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 323.8 bits 1650,  Expect = 4e-90
 Identities = 230/248 92%, Positives = 239/248 96%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VFLGSAHGIAKVPPGPNITA YGD+WLDAKSTWYGKPTGAGPKDNGGACGYKDVDK PF+
Sbjct  5    VFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFN 64
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFKDGRGCGSCFEIKC+KPESCSGE VTV ITDDNEEPIAPYHFDLSGHAF
Sbjct  65   GMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 124
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            GSMAKKGEEQ +RSAGELEL+FRRVKCKYPD TKPTFHVEKGSNPNYLA+LVKY+DGDGD
Sbjct  125  GSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGD 184
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKWIELKESWGAVWR+DTPDKLTGPFTVRYTTEGGTK E EDVIPEGWK
Sbjct  185  VVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWK 244
Query  241  ADTAYEAK 248
            ADT+Y AK
Sbjct  245  ADTSYSAK 252

Sequence Alignment: 7. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 322.4 bits 1643,  Expect = 9e-90
 Identities = 230/248 92%, Positives = 240/248 96%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VFLG+AHGIAKVPPGPNITATYGD+WLDAKSTWYGKPTGAGPKDNGGACGYKDVDK PFS
Sbjct  16   VFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFS 75
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFK GRGCGSCFEIKC+KPESCSGEPV VHITDDNEEPIA YHFDLSG AF
Sbjct  76   GMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAF 135
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            G+MAKKGEEQKLRSAGELELKFRRVKC+YP+GTK TFHVEKGSNPNYLALLVKY+ GDGD
Sbjct  136  GAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGD 195
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKWIELKESWG++WRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK
Sbjct  196  VVAVDIKEKGKDKWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 255
Query  241  ADTAYEAK 248
            ADTAY +K
Sbjct  256  ADTAYASK 263

Sequence Alignment: 8. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 321.6 bits 1639,  Expect = 2e-89
 Identities = 226/248 91%, Positives = 239/248 96%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VF+GSA+GIAKVPPGPNITA YGD+WLDAKSTWYGKPTGAGPKDNGGACGYKDVDK PF+
Sbjct  22   VFVGSAQGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFN 81
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFKDGRGCGSCFE+KCSKPESCSGEP+TVHITDDNEEPIAPYHFDLSGHAF
Sbjct  82   GMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAF 141
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            GSMAKKGEE+ +R AGELEL+FRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKY+DGDGD
Sbjct  142  GSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDGD 201
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKWIELKESWGA+WR+DTPDKLTGPFTVRYTTEGGTK E EDVIPEGWK
Sbjct  202  VVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKAEFEDVIPEGWK 261
Query  241  ADTAYEAK 248
            ADT   +K
Sbjct  262  ADTHDASK 269

Sequence Alignment: 9. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 320.5 bits 1633,  Expect = 4e-89
 Identities = 228/248 91%, Positives = 238/248 95%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VFLGSAHGIAKVPPGPNITA YGD+WLDAKSTWYGKPTGAGPKDNGGACGYK+VDK PF+
Sbjct  16   VFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFN 75
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFKDGRGCGSCFEIKC+KPESCSGE VTV ITDDNEEPIAPYHFDLSGHAF
Sbjct  76   GMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 135
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            GSMAKKGEEQ +RSAGELEL+FRRVKCKYPD TKPTFHVEK SNPNYLA+LVKY+DGDGD
Sbjct  136  GSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGD 195
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKWIELKESWGAVWR+DTPDKLTGPFTVRYTTEGGTK E EDVIPEGWK
Sbjct  196  VVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWK 255
Query  241  ADTAYEAK 248
            ADT+Y AK
Sbjct  256  ADTSYSAK 263

Sequence Alignment: 10. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 319.3 bits 1627,  Expect = 8e-89
 Identities = 227/248 91%, Positives = 237/248 95%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VFLGSAHGIAKVPPGPNITA YGD+WLDAKSTWYGKPTGAGPKDNGGACGYK+VDK PF+
Sbjct  16   VFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFN 75
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFKDGRGCGSCFEIKC+KPESCSGE VTV ITDDNEEPIAPYHFDLSGHAF
Sbjct  76   GMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAF 135
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            GSMAKKGEEQ +RSAGELEL+FRRVKCKYPD TKPTFHVEK SNPNYLA+LVKY+DGDGD
Sbjct  136  GSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGD 195
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKW ELKESWGAVWR+DTPDKLTGPFTVRYTTEGGTK E EDVIPEGWK
Sbjct  196  VVAVDIKEKGKDKWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWK 255
Query  241  ADTAYEAK 248
            ADT+Y AK
Sbjct  256  ADTSYSAK 263

Sequence Alignment: 11. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 314.6 bits 1602,  Expect = 2e-87
 Identities = 222/248 89%, Positives = 237/248 95%, Gaps = 0/248 0%
Query  1    VFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFS 60
            VFLGSAHGI KVPPGPNITATYGD+WLDAKSTWYGKPT AGPKDNGGACGYKDVDKPPFS
Sbjct  16   VFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDNGGACGYKDVDKPPFS 75
Query  61   GMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            GMTGCGNTPIFK GRGCGSCFEIKC+KPE+CSGEPV VHITDDNEEPIA YHFDLSG AF
Sbjct  76   GMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAF 135
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            GSMAKKG+EQKLRSAGE+E++FRRVKCKYP+GTK TFHVEKGSNPNYLALLVK++ GDGD
Sbjct  136  GSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGD 195
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            VVAVDIKEKGKDKWI LKESWGA+WR+DTP+ L GPFTVRYTTEGGTKGEA+DVIPEGWK
Sbjct  196  VVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVIPEGWK 255
Query  241  ADTAYEAK 248
            ADTAYE+K
Sbjct  256  ADTAYESK 263

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 255.3 bits 1291,  Expect = 2e-69
 Identities = 172/240 71%, Positives = 202/240 84%, Gaps = 0/240 0%
Query  8    GIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGN 67
            G  KVPPGPNIT +YGD+WL+AK+TWYG P GAGPKDNGGACGYKDVDK PF GM  CGN
Sbjct  23   GPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGN 82
Query  68   TPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKG 127
             PIFKDG+GCGSCFEIKCSKPE+CS +P  +H+TD N+EPIA YHFDLSG AFG+MAK G
Sbjct  83   DPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDG 142
Query  128  EEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIK 187
            ++++LR AG ++ +FRRVKCKYP  TK TFH+EK SNPNYLALLVKY+ GDGDVV V+IK
Sbjct  143  KDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIK 202
Query  188  EKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 247
            EKG ++W  LKESWGA+WR+DTP  L GPF+VR TTEGG K  AED IP+GWKAD+ Y++
Sbjct  203  EKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKS 262

Sequence Alignment: 13. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 248.0 bits 1253,  Expect = 2e-67
 Identities = 164/241 68%, Positives = 200/241 82%, Gaps = 0/241 0%
Query  8    GIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGN 67
            G  KVPPGPNITA YG +WL+A+ TWYGKP GAGP DNGGACGYKD+DK PF GM  CGN
Sbjct  23   GPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGN 82
Query  68   TPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKG 127
             PIFKDG+GCGSCFE+KCSKPE+CS +PV +HITD N EPIA YHFDLSGHAFG+MAK+G
Sbjct  83   DPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEG 142
Query  128  EEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIK 187
            ++++LR AG ++++FRRV+CKYP  TK TFHVEKGSNPNY+A+LVKY+ GDGDVV V++K
Sbjct  143  KDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELK 202
Query  188  EKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 247
            EKG ++W  L ESWGA+WR+DTP  L GPF++R TTE   K  A DVIP+ WKA+  Y++
Sbjct  203  EKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKS 262
Query  248  K 248
            +
Sbjct  263  E 263

Sequence Alignment: 14. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 240.4 bits 1213,  Expect = 5e-65
 Identities = 167/235 71%, Positives = 191/235 81%, Gaps = 1/235 0%
Query  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
            PGPNITATYGD+WLDAK+T+YG  P GA P D+GGACGYKDVDK PF  MTGCGN PIFK
Sbjct  24   PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFK 83
Query  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
            DG GCGSC+EIKC +P  CSGEPV + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  84   DGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 143
Query  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
            R AGEL L+FRRVKC+YP  TK  FHVEKGSNPNYLALLVKY  GDG++V+VDIK KG D
Sbjct  144  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSD 203
Query  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E EDVIPE WK DT Y++K
Sbjct  204  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSK 259

Sequence Alignment: 15. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 240.4 bits 1213,  Expect = 5e-65
 Identities = 167/235 71%, Positives = 191/235 81%, Gaps = 1/235 0%
Query  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
            PGPNITATYGD+WLDAK+T+YG  P GA P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  24   PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 83
Query  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
            DG  CGSC+EIKC +P  CSGEPV + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  84   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 143
Query  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
            R AGEL L+FRRVKC+YP  TK  FHVEKGSNPNYLALLVKY  GDG++V+VDIK KG D
Sbjct  144  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSD 203
Query  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E EDVIPE WK DT Y++K
Sbjct  204  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSK 259

Sequence Alignment: 16. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 240.4 bits 1213,  Expect = 5e-65
 Identities = 167/235 71%, Positives = 191/235 81%, Gaps = 1/235 0%
Query  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
            PGPNITATYGD+WLDAK+T+YG  P GA P D+GGACGYKDVDK PF  MTGCGN PIFK
Sbjct  24   PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGNEPIFK 83
Query  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
            DG GCGSC+EIKC +P  CSGEPV + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  84   DGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 143
Query  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
            R AGEL L+FRRVKC+YP  TK  FHVEKGSNPNYLALLVKY  GDG++V+VDIK KG D
Sbjct  144  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSD 203
Query  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E EDVIPE WK DT Y++K
Sbjct  204  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSK 259

Sequence Alignment: 17. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 239.2 bits 1207,  Expect = 1e-64
 Identities = 168/235 71%, Positives = 190/235 80%, Gaps = 1/235 0%
Query  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
            PGPNITATYGD+WLDAK+T+YG  P GA P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  24   PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 83
Query  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
            DG GCGSC+EIKC +P  CSGEPV + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  84   DGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 143
Query  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
            R AGEL L+FRRVKC+YP  TK TFHVEKGS+PNYLALLVKY  GDG++V VDIK KG D
Sbjct  144  RKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 203
Query  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
             ++ +K SWGA+WR+D P  L GPFT+R T+E G   E EDVIPE WK DT Y++K
Sbjct  204  VFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSK 259

Sequence Alignment: 18. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 238.3 bits 1202,  Expect = 2e-64
 Identities = 165/235 70%, Positives = 190/235 80%, Gaps = 1/235 0%
Query  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
            PGPNITATYGD+WLDAK+T+YG  P GA P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
            DG  CGSC+EIKC +P  CSGEPV + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
            R AGEL L+FRRVKC+YP  TK  FHVEKGS+PNYLALLVKY  GDG++V VDIK KG D
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y++K
Sbjct  186  EFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241

Sequence Alignment: 19. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 237.7 bits 1199,  Expect = 3e-64
 Identities = 165/235 70%, Positives = 190/235 80%, Gaps = 1/235 0%
Query  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
            PGPNITATYGD+WLDAK+T+YG  P GA P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
Query  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
            DG  CGSC+EIKC +P  CSGEPV + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
Query  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
            R AGEL L+FRRVKC+YP  TK  FHVEKGS+PNYLALLVKY  GDG++V VDIK KG D
Sbjct  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
Query  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y++K
Sbjct  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241

Sequence Alignment: 20. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 235.3 bits 1186,  Expect = 1e-63
 Identities = 171/235 72%, Positives = 192/235 81%, Gaps = 5/235 2%
Query  11   KVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPI 70
            KV  G NIT TYG +WL+ K+TWYGKPTGAGP DNGGACGYKDV+K PF+ M  CGN PI
Sbjct  3    KVAKGKNITETYGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPI 62
Query  71   FKDGRGCGSCFEIKCSKPES--CSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGE 128
            FKDG  CGSCFEIKC KP+   CSGE V VHITD N E IA YHFDL+GHAFG+MAKKG+
Sbjct  63   FKDGL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQ 121
Query  129  EQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKE 188
            E+KL  AG +++KFRRVKCKY  G K TFHVEKGSNPNYLALLVKY+DGDGD+V VDIKE
Sbjct  122  EEKLAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKE 179
Query  189  KGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            KG D +  LK SWGA+WR D+PD +  P TV+ TTEGGTK   +DVIPEGWKADT Y AK
Sbjct  180  KGGDAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK 239

Sequence Alignment: 21. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 234.9 bits 1184,  Expect = 2e-63
 Identities = 159/224 70%, Positives = 184/224 82%, Gaps = 0/224 0%
Query  25   EWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIK 84
            +WLDAK+TWYGKPTGAGP DNGGACGYKDV+K PF+ M  CGN PIFKDG GCGSC+EIK
Sbjct  3    KWLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEIK 62
Query  85   CSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRR 144
            C KP  CSGEPV VHITD N EPIA YHFDL+G AFG+MAKKGEE+KLR AG ++++FRR
Sbjct  63   CDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRR 122
Query  145  VKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAV 204
            VKCKYP  TK  FHVEKG NPNY+ALL+KY  GDGD+VAVDIKEKG +++I LK SWGA+
Sbjct  123  VKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAI 182
Query  205  WRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            WR+D+P  + GP  VR T+EGGT    +D IPEGWKADT Y +K
Sbjct  183  WRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSK 226

Sequence Alignment: 22. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 229.5 bits 1156,  Expect = 8e-62
 Identities = 159/235 67%, Positives = 186/235 79%, Gaps = 1/235 0%
Query  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
            PGPNITATYG +WL+A++T+YG  P GA P D+GGACGYKDVDKPPF GMT CGN PIFK
Sbjct  6    PGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFK 65
Query  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
            DG GC +C+EIKC +P  CSGEPV V ITD N E IA YHFDLSG AFG+MAKKG+E KL
Sbjct  66   DGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKL 125
Query  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
            R AGEL L+FRRVKCKYP GTK TFH+EKGSN +YLALLVKY  GDG++VAVDIK +  D
Sbjct  126  RKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSD 185
Query  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            ++I +K SWGA+WR+D    L GPF++R T+EGG     +DVIP  WK DT Y +K
Sbjct  186  EFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSK 241

Sequence Alignment: 23. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 227.6 bits 1146,  Expect = 3e-61
 Identities = 155/242 64%, Positives = 188/242 77%, Gaps = 2/242 0%
Query  4    GSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMT 63
            G + G  KVPPGPNIT  Y  +WL AK+TWYG+P GAGP DNGGACG K+V+ PP++G T
Sbjct  20   GGSCGPPKVPPGPNITTNYNGKWLPAKATWYGQPNGAGPDDNGGACGIKNVNLPPYNGFT 79
Query  64   GCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSM 123
             CGN PIFKDG+GCGSC+EI+C+KPE CSG+PVTV ITD N EPIAPYHFDLSG AFG+M
Sbjct  80   ACGNPPIFKDGKGCGSCYEIRCNKPE-CSGQPVTVFITDMNYEPIAPYHFDLSGKAFGAM 138
Query  124  AKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVA 183
            AK G   KLR  G ++L+FRRV+CKY  G K  FHVEKGSNPNYLA+LVK++  DGD+V 
Sbjct  139  AKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVL 198
Query  184  VDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADT 243
            +++KEK  D W  +K SWGA+WR+DTP  L  PF++R T+E G K  A+DVIP  WK DT
Sbjct  199  MELKEKSSD-WKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKVIAQDVIPVNWKPDT 257
Query  244  AYEA 247
             Y +
Sbjct  258  VYNS 261

Sequence Alignment: 24. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 226.6 bits 1141,  Expect = 7e-61
 Identities = 163/243 67%, Positives = 186/243 76%, Gaps = 1/243 0%
Query  3    LGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSG 61
            +GSA       PGPNITATY +EW DAK+T+YG  P GA P D+GGACGYK+VDK PF G
Sbjct  23   VGSALCEIGDKPGPNITATYNEEWQDAKATFYGSNPRGAAPDDDGGACGYKNVDKAPFFG 82
Query  62   MTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFG 121
            MTGCGN PIFKDG GCGSCFEIKC +P  CS +PV + ITD N E IA YHFDLSG AFG
Sbjct  83   MTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHIAAYHFDLSGKAFG 142
Query  122  SMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDV 181
            SMAK+G+E  LR AGEL L+FRRVKC+YP  TK TFHVEKG N NYLALLV+Y  GDGD+
Sbjct  143  SMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLALLVEYAAGDGDI 202
Query  182  VAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKA 241
            VAVDIK KG D+++ +K SWGA+WR+D    L GPFTVR T+E G K   EDVIP  WK 
Sbjct  203  VAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKLVQEDVIPADWKP 262
Query  242  DTAY 245
            +TAY
Sbjct  263  NTAY 266

Sequence Alignment: 25. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 224.4 bits 1129,  Expect = 3e-60
 Identities = 155/230 67%, Positives = 183/230 79%, Gaps = 3/230 1%
Query  5    SAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTG 64
            S  G  KVPPGPNIT +YGD+WL+A+     +P    PKDNGGACGYKDVDK PF GM  
Sbjct  20   SPAGHPKVPPGPNITTSYGDKWLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNS 79
Query  65   CGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMA 124
            CGN PIFKDG+GCGSCFEIKCSKPE+CS +P  +H+TD N+EPIA YHFDLSG A   MA
Sbjct  80   CGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MA 136
Query  125  KKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAV 184
            K G++++LR AG ++ +FRRVKCKYP  TK TFH+EK SNPNYLALLVKY+ GDGDVV V
Sbjct  137  KDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEV 196
Query  185  DIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPE 237
            +IKEKG ++W  LKESWGA+WR+DTP  L GPF+VR TTEG  +  AED IP+
Sbjct  197  EIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPD 249

Sequence Alignment: 26. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 221.9 bits 1116,  Expect = 2e-59
 Identities = 148/241 61%, Positives = 185/241 76%, Gaps = 2/241 0%
Query  4    GSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMT 63
            G + G  KVPPGPNIT  Y  +WL A++TWYG+P GAG  DNGGACG K+V+ PP+SGMT
Sbjct  21   GGSCGPPKVPPGPNITTNYNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMT 80
Query  64   GCGNTPIFKDGRGCGSCFEIKCS-KPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGS 122
             CGN PIFKDG+GCGSC+E++C  KPE CSG PVTV+ITD N EPIAPYHFDLSG AFGS
Sbjct  81   ACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVYITDMNYEPIAPYHFDLSGKAFGS 139
Query  123  MAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVV 182
            +AK G   K+R  G ++++FRRV+CKYP G K  FH+EKG NPNYLA+LVKY+  DGD+V
Sbjct  140  LAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIV 199
Query  183  AVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKAD 242
             ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K  A+DVIP  W+ D
Sbjct  200  LMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPD 259
Query  243  TAY 245
              Y
Sbjct  260  AVY 262

Sequence Alignment: 27. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 217.3 bits 1092,  Expect = 4e-58
 Identities = 144/242 59%, Positives = 181/242 74%, Gaps = 0/242 0%
Query  4    GSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMT 63
            G + G  KVPPGPNIT  Y   WL A++TWYG+P G+G  DNGGACG K+V+ PP++GM 
Sbjct  21   GGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMI 80
Query  64   GCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSM 123
             CGN PIFKDGRGCGSC+E+KC +P +CS +PVTV ITD N EPI+ YHFD+SG AFG+M
Sbjct  81   SCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAM 140
Query  124  AKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVA 183
            A  G+E +LR AG ++++FRRV+CKYP G K TFHVEKGSNPNYLA+LVK++  DGDV+ 
Sbjct  141  ACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQ 200
Query  184  VDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADT 243
            +D++E G   W  +K SWGA+WR+DT   L  PF++R TTE G    A+DVIP  W  D 
Sbjct  201  MDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDA 260
Query  244  AY 245
             Y
Sbjct  261  IY 262

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 187.9 bits 938,  Expect = 3e-49
 Identities = 128/237 54%, Positives = 169/237 71%, Gaps = 5/237 2%
Query  9    IAKVPPGPNITA---TYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGC 65
            +A   PG N +A   T    W  A++TWYG PTGAGP D+GGACG+K+ ++ PFS MT C
Sbjct  23   VAGARPG-NFSASDFTADPNWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSC 81
Query  66   GNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAK 125
            GN PIFKDG+GCGSC++I+C    +CSG P TV ITD N  P++ YHFDLSG AFG+MAK
Sbjct  82   GNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAK 141
Query  126  KGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVD 185
             G+  +LR AG ++++F+RV C +P G K TFHVE+GSNP Y+A+LV+Y DGDGDVV VD
Sbjct  142  PGQNDQLRHAGIIDIQFKRVPCNFP-GLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVD 200
Query  186  IKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245
            + E     W  ++ESWG++WR+D+  +LT PF++R T E G +  A  VIP  W     Y
Sbjct  201  LMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVY 260
Query  246  EA 247
             +
Sbjct  261  RS 262

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 186.2 bits 929,  Expect = 1e-48
 Identities = 131/240 54%, Positives = 172/240 71%, Gaps = 10/240 4%
Query  7    HGIAKVPP-GPNIT--ATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMT 63
            HG  K  P   N++  + YG  WL A++TWYG PTGAGP DNGGACG+K+V++ PFS MT
Sbjct  22   HGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGGACGFKNVNQYPFSSMT 81
Query  64   GCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSM 123
             CGN PIFKDG+GCGSC++I+C+K  SCSG   TV ITD N  P+A YHFDLSG AFG+M
Sbjct  82   SCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAM 141
Query  124  AKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVA 183
            AK G   KLR +G ++++FRRV C YP G K  FHVE+GSNP Y+A+LV+Y D DGDVV 
Sbjct  142  AKPGLNDKLRHSGIIDIQFRRVPCNYP-GLKINFHVEEGSNPVYFAVLVEYEDLDGDVVQ 200
Query  184  VDIKEK------GKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPE 237
            VD+ E           W  ++ESWG++WR+D+  +L  PF++R  ++ G    A +VIP 
Sbjct  201  VDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPA 260
Query  238  GWKADTAYEA 247
             W  ++ Y +
Sbjct  261  NWSPNSNYRS 270

Sequence Alignment: 30. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 181.2 bits 903,  Expect = 3e-47
 Identities = 122/227 53%, Positives = 162/227 71%, Gaps = 7/227 3%
Query  20   ATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGS 79
            A Y   W  A++TWYG+P GAGP DNGGACG+K  ++ PF  MT CGN P+FKDG+GCGS
Sbjct  49   AVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGS 108
Query  80   CFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELE 139
            C++I+C+K +SCSG   TV ITD N  P+AP+HFDLSG AFG +AK G   KLR +G ++
Sbjct  109  CYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIID 168
Query  140  LKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGK------DK 193
            ++F RV C++P G K  FHVE+ SNP Y+A+LV+Y DGDGDVV VD+ E          K
Sbjct  169  IEFTRVPCEFP-GLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGK 227
Query  194  WIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 247
            W  ++ESWG++WR+DT  +L  PF++R   E G    A +VIP  W+ +T Y +
Sbjct  228  WTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRS 281

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 177.3 bits 882,  Expect = 5e-46
 Identities = 119/226 52%, Positives = 162/226 71%, Gaps = 6/226 2%
Query  22   YGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCF 81
            Y ++WL AK+TWYG+P GAGP DNGGACG+K+ ++ PF  MT CGN P+F+DG+GCG+C+
Sbjct  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
Query  82   EIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELK 141
            +I+C+   SCSG+P TV ITD N  P+A YHFDLSG AFG+MA+ G   +LR AG ++++
Sbjct  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
Query  142  FRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEK---GKDK--WIE 196
            FRRV C Y  G    FHVE GSNP YLA+LV++ + DG VV +D+ E    GK    W  
Sbjct  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
Query  197  LKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            ++ SWG++WR+D   +L GP ++R  +E G    A  VIP  W+A+T Y +K
Sbjct  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSK 257

Sequence Alignment: 32. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 175.3 bits 872,  Expect = 2e-45
 Identities = 121/227 53%, Positives = 162/227 71%, Gaps = 7/227 3%
Query  18   ITATYGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGC 77
            +  +Y   WL AK+TWYG P GAGP DNGGACG+K+V++ P S M  CGN PIF  G GC
Sbjct  32   VARSYTSGWLPAKATWYGAPNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEGC 91
Query  78   GSCFEIKC--SKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSA 135
            G C+EIKC  S   SCSG+P  + ITD N  P+A YH+DLSG AFGSMAK G   +LR A
Sbjct  92   GMCYEIKCEYSNNPSCSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDRLRHA 151
Query  136  GELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKE--KGKDK 193
            G ++++FRRV C +P G K TFHV++GSNPNYLA+LV+Y++ DG VV +++ +   G+  
Sbjct  152  GIIDMQFRRVPCNFP-GMKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNGRPT 210
Query  194  --WIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245
              W +++ SWG+VWR+DT   + GPF++R T++ G    A + IP  W+ D AY
Sbjct  211  GYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAY 264

Sequence Alignment: 33. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 175.3 bits 872,  Expect = 2e-45
 Identities = 116/221 52%, Positives = 159/221 71%, Gaps = 3/221 1%
Query  26   WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKC 85
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
Query  86   SKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRV 145
            ++  +CSG   TV ITD N  P++ YHFDLSG AFG +AK G    LR AG ++++F RV
Sbjct  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
Query  146  KCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD--KWIELKESWGA 203
             C++P G K  FHVE+GS+P YLA+LV+Y +GDGDV  VD+KE G    +W  ++ESWG+
Sbjct  163  PCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
Query  204  VWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 247
            VWR+D+  +L  PF++R  ++ G    A DVIP  W  +T Y +
Sbjct  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRS 265

Sequence Alignment: 34. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 166.1 bits 823,  Expect = 8e-43
 Identities = 110/183 60%, Positives = 140/183 76%, Gaps = 2/183 1%
Query  62   MTGCGNTPIFKDGRGCGSCFEIKCS-KPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAF 120
            MT CGN PIFKDG+GCGSC+E++C  KPE CSG PVTV ITD N EPIAPYHFDLSG AF
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPE-CSGNPVTVFITDMNYEPIAPYHFDLSGKAF 59
Query  121  GSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGD 180
            GS+AK G   KLR  G ++++FRRV+CKYP G K  FH+EKG NPNY+A+LVK++  DGD
Sbjct  60   GSLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGD 119
Query  181  VVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWK 240
            +V ++I++K   +W  +K SWGA+WR+DT   L GPF++R T+E G K  A+D+IP  W+
Sbjct  120  IVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWR 179
Query  241  ADTAY 245
             D  Y
Sbjct  180  PDAVY 184

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 153.5 bits 758,  Expect = 8e-39
 Identities = 128/222 57%, Positives = 165/222 74%, Gaps = 11/222 4%
Query  23   GDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFE 82
            G  WL+A++TWYG P GAGP DNGGACG+K+V+ PPFS MT CGN P+FKDG+GCGSC++
Sbjct  89   GGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQ 148
Query  83   IKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKF 142
            I+C    +CSG P TV ITD N  P++ YHFDLSG AFG+MAK     +LR AG ++++F
Sbjct  149  IRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQF 208
Query  143  RRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEK-----GKDK---- 193
            RRV C+YP G   TFHVE+GSNP Y+A+LV+Y +GDGDVV VD+ E      G D     
Sbjct  209  RRVPCQYP-GLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTG 267
Query  194  -WIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245
             W  ++ESWG++WR+DT   L GPF++R T E G    A+ VIP  W+ +T Y
Sbjct  268  VWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVY 320

Sequence Alignment: 36. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 146.7 bits 722,  Expect = 8e-37
 Identities = 104/220 47%, Positives = 144/220 65%, Gaps = 8/220 3%
Query  25   EWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKPPFSGMTGCGNTPIFKDGRGCGSCFEI 83
            +W  A +TWYG   G G    GGACGY + V +PPFS +   G+  I+  G+GCGSC+E+
Sbjct  47   DWSPAVATWYGPANGDG--SEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEV 104
Query  84   KCSKPESCSGEPVTVHITDDNEE--PIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELK 141
            KC+   +CSG PV V ITD+       A YHFDLSG+AFG+MA  G+++ LR+AG++ ++
Sbjct  105  KCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQ 164
Query  142  FRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEK-GKDKWIELKES 200
             RR++C YP G    FHV+ GSN  Y+A LV+Y DGDGD+  V++KE      W  +++S
Sbjct  165  HRRIECNYP-GRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQS 223
Query  201  WGAVWRVDTPDKLTGPFTVRYTT-EGGTKGEAEDVIPEGWKADTAYEA 247
            WGAVW+ D    L  PF+++ TT E G    A +VIP GW     Y +
Sbjct  224  WGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRS 271

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 144.4 bits 710,  Expect = 4e-36
 Identities = 106/220 48%, Positives = 147/220 66%, Gaps = 13/220 5%
Query  22   YGDEWLDAKSTWYGKPTGAGPKDNGGACGYKD-VDKPPFSGMTGCGNTPIFKDGRGCGSC 80
            YG  W    +TWYG P G G +  GGACGY+  V + PFS M   G   +FK+G+GCGSC
Sbjct  43   YG--WSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
Query  81   FEIKCSKPESCSGEPVTVHITDDNEEPIA---PYHFDLSGHAFGSMAKKGEEQKLRSAGE 137
            ++IKC+   +CSG PVTV ITD     +      HFD+SG AFG+MA +G   +LRSAG 
Sbjct  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
Query  138  LELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDI-KEKGKDKWIE 196
            L+++++RV C++       F V+ GSNP YLA+LV+Y +GDGD+ AV I K +G   W  
Sbjct  159  LKIQYKRVPCRF--AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
Query  197  LKESWGAVWRVD--TPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 247
            +++SWGA WR++  T   L+ PF++R T+  G    A +VIP GW+A   Y +
Sbjct  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRS 269

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 89.7 bits 423,  Expect = 1e-19
 Identities = 74/197 37%, Positives = 112/197 56%, Gaps = 13/197 6%
Query  45   NGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDN 104
            + GAC Y  +    F+G        I+KDG GCG+CF+++C  P  CS +  TV +TD N
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN 100
Query  105  EEPIAPYHFDLSGHAFGSMAKK--GEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKG 162
            +       + LS  AF +MAK   G ++ L   G +++++RRV C Y +  K    VE+ 
Sbjct  101  KT--NQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDYGN-KKMNVRVEES 157
Query  163  S-NPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVD-TPDKLTGPFTVR 220
            S NPNYLA+ + Y  G  +VVA+ I + G   W  +  S GAVW  D  P+   G +  R
Sbjct  158  SKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSHWSYMTRSHGAVWVTDKVPN---GALQFR 214
Query  221  YTTEGGTKGE---AEDVIPEGWKADTAYEA 247
            +    G  G+   ++ V+P  W+A  +Y+A
Sbjct  215  FVVTAGYDGKMVWSQRVLPANWEAGKSYDA 244

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 80.5 bits 375,  Expect = 7e-17
 Identities = 83/218 38%, Positives = 120/218 55%, Gaps = 37/218 16%
Query  14   PGPNITATYG-DEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPP-FSGMTGCGNTPIF 71
            P P     Y   +W D  +T+YG P+G G  D GGACGY   D    +S  T   +TP+F
Sbjct  39   PAPGAVTPYKTSDWHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLF 97
Query  72   KDGRGCGSCFEIKCSKPESCS-GEPVTVHITDDNEEPIAPY--------------HFDLS 116
             DG GCG C+E++C K   C+ G P +V IT  N  P   Y              HFD++
Sbjct  98   ADGNGCGQCYELRCVKSPWCNPGSP-SVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMA 156
Query  117  GHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYID 176
              +F  +A+       R AG + +++RRV C+   G +  F ++   N  +L L V  + 
Sbjct  157  PPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVR--FCLQ--GNHYWLLLYVMNVG 205
Query  177  GDGDVVAVDIKEKGKD-KWIELKESWGAVWRV----DTPDKLTGPFTVRYTTEGGTKGEA 231
            G GDV ++ +K  G    WI+   +WG  ++V    D  D LT  +T  Y+T   T    
Sbjct  206  GAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT-YSTPQQTII-V 263
Query  232  EDVIPEGWKADTAYE 246
             D I   W     Y+
Sbjct  264  SDAISPWWITGLCYQ 278

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 80.3 bits 374,  Expect = 7e-17
 Identities = 62/200 31%, Positives = 101/200 50%, Gaps = 8/200 4%
Query  45   NGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCSKPESCSGEPVTVHITDDN 104
            N G+CGY  +      G     +  +F+ G GCG+CF+++C   + CS     V +TD+ 
Sbjct  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEA 109
Query  105  EEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGSN 164
                    + LS  A+ +MA+ G   +LR+   ++++++RV C+Y  G   +  VE+ S 
Sbjct  110  RST-NRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
Query  165  PNY-LALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGPFTVRYTT 223
            P   L++   Y  G  D+VAVD+   G   W  +   +G  W   T     GP+  R   
Sbjct  169  PPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQFRVVV 226
Query  224  EGGTKGE---AE-DVIPEGWKADTAYEA 247
             GG  G+   A+ +V+P  W A   Y+A
Sbjct  227  TGGYDGKWVWADGEVLPRRWTAGRVYDA 254

Sequence Alignment: 41. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 60.3 bits 267,  Expect = 4e-11
 Identities = 41/89 46%, Positives = 58/89 65%, Gaps = 4/89 4%
Query  154  KPTFHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPDK 212
            K TF VEKGSN  +LA+LVKY   +GD +A V+++E G D+W+ + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  213  LTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245
            L GPF  R+ TE G K   +DV+PE +     Y
Sbjct  86   LKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 60.3 bits 267,  Expect = 4e-11
 Identities = 41/89 46%, Positives = 58/89 65%, Gaps = 4/89 4%
Query  154  KPTFHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPDK 212
            K TF VEKGSN  +LA+LVKY   +GD +A V+++E G D+W+ + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  213  LTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245
            L GPF  R+ TE G K   +DV+PE +     Y
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 60.3 bits 267,  Expect = 4e-11
 Identities = 41/89 46%, Positives = 58/89 65%, Gaps = 4/89 4%
Query  154  KPTFHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPDK 212
            K TF VEKGSN  +LA+LVKY   +GD +A V+++E G D+W+ + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  213  LTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245
            L GPF  R+ TE G K   +DV+PE +     Y
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 60.3 bits 267,  Expect = 4e-11
 Identities = 41/89 46%, Positives = 58/89 65%, Gaps = 4/89 4%
Query  154  KPTFHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPDK 212
            K TF VEKGSN  +LA+LVKY   +GD +A V+++E G D+W+ + +  G VW  D+ + 
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY---EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEP 85
Query  213  LTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245
            L GPF  R+ TE G K   +DV+PE +     Y
Sbjct  86   LQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 55.1 bits 237,  Expect = 4e-10
 Identities = 32/34 94%, Positives = 33/34 97%, Gaps = 0/34 0%
Query  9    IAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGP 42
            I KVPPGPNITATYGD+WLDAKSTWYGKPTGAGP
Sbjct  1    IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGP 34

Sequence Alignment: 46. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 55.0 bits 239,  Expect = 1e-09
 Identities = 36/89 40%, Positives = 57/89 64%, Gaps = 2/89 2%
Query  157  FHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPDKLTG 215
            F VEKGS+   LAL +KY + +GD +A V++KE G ++W+ LK++   VW + +   L G
Sbjct  6    FTVEKGSDEKNLALSIKY-NKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 64
Query  216  PFTVRYTTEGGTKGEAEDVIPEGWKADTAYE 246
            PF  R+ +E G +   +DV+P  +K  T Y+
Sbjct  65   PFNFRFVSEKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 47. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 52.8 bits 225,  Expect = 2e-09
 Identities = 31/32 96%, Positives = 32/32 100%, Gaps = 0/32 0%
Query  9    IAKVPPGPNITATYGDEWLDAKSTWYGKPTGA 40
            IAKVPPGPNITATYGD+WLDAKSTWYGKPTGA
Sbjct  1    IAKVPPGPNITATYGDKWLDAKSTWYGKPTGA 32

Sequence Alignment: 48. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 53.1 bits 229,  Expect = 4e-09
 Identities = 37/90 41%, Positives = 56/90 62%, Gaps = 3/90 3%
Query  154  KPTFHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPDK 212
            K TF VEKGS+P  L L +KY    GD +A V++++ G ++W  L +  G +W V +   
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
Query  213  LTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245
            LTGPF  R+ ++GG +   ++VIP  +K  T Y
Sbjct  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 49. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 52.2 bits 224,  Expect = 7e-09
 Identities = 35/86 40%, Positives = 53/86 61%, Gaps = 2/86 2%
Query  157  FHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPDKLTG 215
            F VEKGS+   LAL +KY   +GD +A V++KE G ++W+ LK++   VW + +   L G
Sbjct  2    FTVEKGSDEKNLALSIKY-SKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG 60
Query  216  PFTVRYTTEGGTKGEAEDVIPEGWKADT 243
            PF  R+ +E G     +DV+P  +K  T
Sbjct  61   PFNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 50. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 50.6 bits 216,  Expect = 3e-08
 Identities = 38/85 44%, Positives = 52/85 61%, Gaps = 7/85 8%
Query  157  FHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTGP 216
            FHVE+ S+P + AL +K  D   ++  VD++E G D    + +S G  W +D P  L GP
Sbjct  24   FHVEE-SSPKF-ALSIK--DSAKEITQVDVREHGADNMDPMTKS-GDSWTIDKP--LKGP 76
Query  217  FTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            + +R   EGG     +DVIPE WKA T Y  K
Sbjct  77   LNIRLRAEGGGSRVQDDVIPENWKAGTDYPTK 108

Sequence Alignment: 51. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 48.9 bits 207,  Expect = 8e-08
 Identities = 30/90 33%, Positives = 50/90 55%, Gaps = 1/90 1%
Query  156  TFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKLTG 215
            TF V+KGS+P  L L +KY      +  V++++ G ++W  L +  G VW V +   L G
Sbjct  16   TFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSSKPLVG 74
Query  216  PFTVRYTTEGGTKGEAEDVIPEGWKADTAYE 246
            PF  R+ ++GG +   ++VIP  +     Y+
Sbjct  75   PFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 52. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 45.5 bits 189,  Expect = 8e-07
 Identities = 32/91 35%, Positives = 52/91 57%, Gaps = 3/91 3%
Query  153  TKPTFHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPD 211
            TK  + VEKGS+   L L +KY    GD +A V++++ G ++W  + +  G +W V +  
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTR-PGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAK 58
Query  212  KLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245
             LTGP   R+ ++GG K   ++VIP  +     Y
Sbjct  59   PLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92

Sequence Alignment: 53. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 41.6 bits 169,  Expect = 1e-05
 Identities = 28/92 30%, Positives = 47/92 51%, Gaps = 1/92 1%
Query  154  KPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIELKESWGAVWRVDTPDKL 213
            K  + V+KGS+   LAL + Y   +  +  V++++ G ++W  L +  G VW V     L
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKK-GDVWEVSCSKPL 82
Query  214  TGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYE 246
             GPF  R+ ++ G K   ++V    +K    YE
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTYE 115

Sequence Alignment: 54. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 35.1 bits 135,  Expect = 0.001
 Identities = 27/88 30%, Positives = 47/88 53%, Gaps = 6/88 6%
Query  156  TFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIE-LKESWGAVWRVDTPDKLT 214
            T+ + K S    L L+        DV  V +K+KG   + + LKES    +  ++ + + 
Sbjct  28   TWTIGKDSTSTRLVLVAS-----ADVSEVAVKDKGATDFSDDLKESPAKTFTYESKEPIK 82
Query  215  GPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248
            GP++VR+  +G      +DVIP  +K  + Y+ K
Sbjct  83   GPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTK 116

Sequence Alignment: 55. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 34.1 bits 130,  Expect = 0.003
 Identities = 27/90 30%, Positives = 45/90 50%, Gaps = 6/90 6%
Query  152  GTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKDKWIE-LKESWGAVWRVDTP 210
            GT  T  V K S    L+L+         +  V +K KG   + + LKES    + +D+ 
Sbjct  26   GTTLTIEVGKDSTSTKLSLITNVA-----ISEVSVKPKGATDFTDDLKESEPKTFTLDSK 80
Query  211  DKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYE 246
            + + GP   R+  +GG     ++ IP  +KA + Y+
Sbjct  81   EPIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYK 116

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.