The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD
LLQKLRDKGVDVDHYIELIRALFGLTREARNLQDDLNDFLALIPTDQILAIAMDYLANDA
EVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPFVPP
SRRHARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKALYDAIRSPEFQSIISTL
NAMPEYQELLQNLRDKGVDVDHFIELIRSWFGLP
Sequence Info Allergen Name Length Opt Bits Score E Value
AAC34737 Per a 1.0104 274 1784 413.3 4.8e-117
AAB82404 Per a 1.0103 395 1733 401.5 2.4e-113
AAD13533 Per a 1.0101 231 1423 331.0 2.3e-92
AAC34312 Per a 1.0102 228 1401 326.0 7.2e-91
AAC34736 Per a 1.0201 446 1347 313.5 8.3e-87
AAD13531 Bla g 1.02 492 1315 306.2 1.5e-84
AAD13530 Bla g 1.0101 412 965 226.5 1.2e-60
AAD13532 Bla g 1.0103 188 841 198.5 1.5e-52
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Per a 1.0104 Sequence ID: AAC34737

 Score = 413.3 bits 1784,  Expect = 5e-117
 Identities = 274/274 100%, Positives = 274/274 100%, Gaps = 0/274 0%
Query  1    VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD 60
            VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD
Sbjct  1    VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD 60
Query  61   LLQKLRDKGVDVDHYIELIRALFGLTREARNLQDDLNDFLALIPTDQILAIAMDYLANDA 120
            LLQKLRDKGVDVDHYIELIRALFGLTREARNLQDDLNDFLALIPTDQILAIAMDYLANDA
Sbjct  61   LLQKLRDKGVDVDHYIELIRALFGLTREARNLQDDLNDFLALIPTDQILAIAMDYLANDA 120
Query  121  EVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPFVPP 180
            EVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPFVPP
Sbjct  121  EVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPFVPP 180
Query  181  SRRHARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKALYDAIRSPEFQSIISTL 240
            SRRHARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKALYDAIRSPEFQSIISTL
Sbjct  181  SRRHARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKALYDAIRSPEFQSIISTL 240
Query  241  NAMPEYQELLQNLRDKGVDVDHFIELIRSWFGLP 274
            NAMPEYQELLQNLRDKGVDVDHFIELIRSWFGLP
Sbjct  241  NAMPEYQELLQNLRDKGVDVDHFIELIRSWFGLP 274

Sequence Alignment: 2. Allergen Name: Per a 1.0103 Sequence ID: AAB82404

 Score = 401.5 bits 1733,  Expect = 2e-113
 Identities = 268/274 97%, Positives = 269/274 98%, Gaps = 0/274 0%
Query  1    VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD 60
            VGVDGLIDDIIAILPIDDLKALFQEKLETS DFKAFYDAVRSPEFQSIVQTLNAMPEYQD
Sbjct  122  VGVDGLIDDIIAILPIDDLKALFQEKLETSPDFKAFYDAVRSPEFQSIVQTLNAMPEYQD 181
Query  61   LLQKLRDKGVDVDHYIELIRALFGLTREARNLQDDLNDFLALIPTDQILAIAMDYLANDA 120
            LLQKLRDKGVDVDHYIELIRALFGLTR ARNLQDDLNDFLALIPTDQILAIAMDYLANDA
Sbjct  182  LLQKLRDKGVDVDHYIELIRALFGLTRAARNLQDDLNDFLALIPTDQILAIAMDYLANDA 241
Query  121  EVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPFVPP 180
            EVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVA+YINEIHSIIGLPPFVPP
Sbjct  242  EVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVADYINEIHSIIGLPPFVPP 301
Query  181  SRRHARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKALYDAIRSPEFQSIISTL 240
            SRRHARRGVGINGLIDDVIAILPVDELK LFQEKLETSPDFKALYDAIRSPEFQSIISTL
Sbjct  302  SRRHARRGVGINGLIDDVIAILPVDELKALFQEKLETSPDFKALYDAIRSPEFQSIISTL 361
Query  241  NAMPEYQELLQNLRDKGVDVDHFIELIRSWFGLP 274
            NAMPEYQELLQNLRDK VDVDHFIELIRS FGLP
Sbjct  362  NAMPEYQELLQNLRDKAVDVDHFIELIRSLFGLP 395
 Score = 113.4 bits 469,  Expect = 1e-26
 Identities = 69/106 65%, Positives = 81/106 76%, Gaps = 1/106 0%
Query  83   FGLTREARNLQDDLNDFLALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIINTIE 142
            FG +   RNLQDDLNDFLAL+P D+I AI MDYLANDAEVQE VAYLQ ++FHKI+ T+E
Sbjct  15   FGKSLPNRNLQDDLNDFLALLPVDEITAIVMDYLANDAEVQEAVAYLQGEEFHKIVFTVE 74
Query  143  ALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPFVPPSRR-HARRG 188
             L EF NF  FL+ HGLD   YIN +HS+ G  P+VP S+R H RRG
Sbjct  75   GLQEFGNFVQFLEDHGLDAVGYINRLHSVFGWDPYVPSSKRKHTRRG 121

Sequence Alignment: 3. Allergen Name: Per a 1.0101 Sequence ID: AAD13533

 Score = 331.0 bits 1423,  Expect = 2e-92
 Identities = 217/231 93%, Positives = 223/231 96%, Gaps = 0/231 0%
Query  44   EFQSIVQTLNAMPEYQDLLQKLRDKGVDVDHYIELIRALFGLTREARNLQDDLNDFLALI 103
            EFQSI+ TLNAMPEYQ+LLQ LRDKGVDVDHYIELIRALFGLTR ARNLQDDLNDFLALI
Sbjct  1    EFQSIISTLNAMPEYQELLQNLRDKGVDVDHYIELIRALFGLTRAARNLQDDLNDFLALI 60
Query  104  PTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVAN 163
            PTDQILAIAMDYLANDAEVQELVAYLQSDDFHKII TIE LPEFANFYNFLK HGLDVA+
Sbjct  61   PTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIITTIEGLPEFANFYNFLKEHGLDVAD 120
Query  164  YINEIHSIIGLPPFVPPSRRHARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKA 223
            ++NEIHSIIGLPPFVPPSRRHARRGVGINGLIDDVIAILPVDELK LFQEKLETSPDFKA
Sbjct  121  FLNEIHSIIGLPPFVPPSRRHARRGVGINGLIDDVIAILPVDELKALFQEKLETSPDFKA 180
Query  224  LYDAIRSPEFQSIISTLNAMPEYQELLQNLRDKGVDVDHFIELIRSWFGLP 274
            LYDAIRSPEFQSIISTLNAMPEYQ+LLQNLRDKGVDVDHFIELIRS FGLP
Sbjct  181  LYDAIRSPEFQSIISTLNAMPEYQDLLQNLRDKGVDVDHFIELIRSLFGLP 231

Sequence Alignment: 4. Allergen Name: Per a 1.0102 Sequence ID: AAC34312

 Score = 326.0 bits 1401,  Expect = 7e-91
 Identities = 214/228 93%, Positives = 219/228 96%, Gaps = 0/228 0%
Query  47   SIVQTLNAMPEYQDLLQKLRDKGVDVDHYIELIRALFGLTREARNLQDDLNDFLALIPTD 106
            SI+ TLNAMPEYQDLLQ LRDKGVDVDHYIELIRALFGLTR ARNLQDDLNDFLALIPTD
Sbjct  1    SIISTLNAMPEYQDLLQNLRDKGVDVDHYIELIRALFGLTRAARNLQDDLNDFLALIPTD 60
Query  107  QILAIAMDYLANDAEVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYIN 166
            QILAIAMDYLANDAEVQELVAYLQSDDFHKII TIE LPEFANFYNFLK HGLDVA+++N
Sbjct  61   QILAIAMDYLANDAEVQELVAYLQSDDFHKIITTIEGLPEFANFYNFLKEHGLDVADFLN 120
Query  167  EIHSIIGLPPFVPPSRRHARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKALYD 226
            EIHSIIGLPPFVPPSRRHARRGVGINGLIDDVIAILPVDELK LF EKLETSPDFKALYD
Sbjct  121  EIHSIIGLPPFVPPSRRHARRGVGINGLIDDVIAILPVDELKALFDEKLETSPDFKALYD 180
Query  227  AIRSPEFQSIISTLNAMPEYQELLQNLRDKGVDVDHFIELIRSWFGLP 274
            AIRSPEFQSIISTLNAMPEYQ+LLQNLRDKGVDVDHFIELIRS FGLP
Sbjct  181  AIRSPEFQSIISTLNAMPEYQDLLQNLRDKGVDVDHFIELIRSLFGLP 228

Sequence Alignment: 5. Allergen Name: Per a 1.0201 Sequence ID: AAC34736

 Score = 313.5 bits 1347,  Expect = 8e-87
 Identities = 211/263 80%, Positives = 232/263 88%, Gaps = 4/263 1%
Query  1    VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD 60
            VG++GLIDD+IAILP+D+LKALFQEKLETS DFKA+YDA+RSPEFQSI+ TLNAM +  +
Sbjct  25   VGINGLIDDVIAILPVDELKALFQEKLETSPDFKALYDAIRSPEFQSIISTLNAM-QRSE 83
Query  61   LLQKLRDKGVDVDHYIELIRALFGLTREARNLQDDLNDFL-ALIPTDQILAIAMDYLAND 119
              Q LRDKGVDVDH+I+LIRALFGL+R ARNLQDDLNDFL +L P        +      
Sbjct  84   HHQNLRDKGVDVDHFIQLIRALFGLSRAARNLQDDLNDFLHSLEPISPRHRHGLPRQRRR 143
Query  120  AEVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPFVP 179
            +    + AYL++DDFHKII TIEALPEFANFYNFLK HGLDV +YINEIHSIIGLPPFVP
Sbjct  144  S--ARVSAYLHADDFHKIITTIEALPEFANFYNFLKEHGLDVVDYINEIHSIIGLPPFVP 201
Query  180  PSRRHARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKALYDAIRSPEFQSIIST 239
            PSRRHARRGVGINGLIDDVIAILPVDELK LFQEKLETSPDFKALYDAIRSPEFQSIIST
Sbjct  202  PSRRHARRGVGINGLIDDVIAILPVDELKALFQEKLETSPDFKALYDAIRSPEFQSIIST 261
Query  240  LNAMPEYQELLQNLRDKGVDVDHFIEL 266
            LNAMPEYQELLQNLRDKGVDVDHFI +
Sbjct  262  LNAMPEYQELLQNLRDKGVDVDHFIRV 288
 Score = 204.8 bits 870,  Expect = 4e-54
 Identities = 134/144 93%, Positives = 137/144 95%, Gaps = 0/144 0%
Query  85   LTREARNLQDDLNDFLALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIINTIEAL 144
            L+   RNLQDDLNDFLALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKII TIEAL
Sbjct  296  LSSGQRNLQDDLNDFLALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIITTIEAL 355
Query  145  PEFANFYNFLKGHGLDVANYINEIHSIIGLPPFVPPSRRHARRGVGINGLIDDVIAILPV 204
            PEFANFYNFLK HGLDV +YINEIHSIIGLPPFVPPS+RHARRGVGINGLIDDVIAILPV
Sbjct  356  PEFANFYNFLKEHGLDVVDYINEIHSIIGLPPFVPPSQRHARRGVGINGLIDDVIAILPV 415
Query  205  DELKTLFQEKLETSPDFKALYDAI 228
            DELK LFQEKLETSPDFKALYDAI
Sbjct  416  DELKALFQEKLETSPDFKALYDAI 439

Sequence Alignment: 6. Allergen Name: Bla g 1.02 Sequence ID: AAD13531

 Score = 306.2 bits 1315,  Expect = 1e-84
 Identities = 196/273 71%, Positives = 229/273 83%, Gaps = 0/273 0%
Query  1    VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD 60
            VG+ GLIDDIIAILP+DDL ALFQEKLETS +FKA+YDA+RSPEFQSIV+TL AMPEYQ 
Sbjct  218  VGITGLIDDIIAILPVDDLYALFQEKLETSPEFKALYDAIRSPEFQSIVETLKAMPEYQS 277
Query  61   LLQKLRDKGVDVDHYIELIRALFGLTREARNLQDDLNDFLALIPTDQILAIAMDYLANDA 120
            L+QKL+DKGVDVDH IELI  +F + R+ R L +DL DFLALIP DQILAIA DYLANDA
Sbjct  278  LIQKLKDKGVDVDHIIELIHQIFNIVRDTRGLPEDLQDFLALIPIDQILAIAADYLANDA 337
Query  121  EVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPFVPP 180
            EVQ  V YL+SD+F  I+ T+++LPEF NF NFL+ +GL+   +IN IH ++G+P     
Sbjct  338  EVQAAVEYLKSDEFETIVVTVDSLPEFKNFLNFLQTNGLNAIEFINNIHDLLGIPHIPAT 397
Query  181  SRRHARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKALYDAIRSPEFQSIISTL 240
             R+H RRGVGINGLIDDVIAILPVDEL  LFQEKLE+SP+FKALYDAIRSPEFQSI+ TL
Sbjct  398  GRKHVRRGVGINGLIDDVIAILPVDELYALFQEKLESSPEFKALYDAIRSPEFQSIVQTL 457
Query  241  NAMPEYQELLQNLRDKGVDVDHFIELIRSWFGL 273
             AMPEYQ+L+Q L+DKGVDVDHFIELI+  FGL
Sbjct  458  KAMPEYQDLIQRLKDKGVDVDHFIELIKKLFGL 490
 Score = 197.0 bits 836,  Expect = 1e-51
 Identities = 123/188 65%, Positives = 152/188 80%, Gaps = 0/188 0%
Query  1    VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD 60
            VG+ GLIDDIIAILP+DDL ALFQEKLETS +FKA+YDA+RSPEFQSIV TL AMPEYQ+
Sbjct  30   VGITGLIDDIIAILPVDDLYALFQEKLETSPEFKALYDAIRSPEFQSIVGTLEAMPEYQN 89
Query  61   LLQKLRDKGVDVDHYIELIRALFGLTREARNLQDDLNDFLALIPTDQILAIAMDYLANDA 120
            L+QKL+DKGVDVDH IELI  +F + R+ R L +DL DFLALIPTDQ+LAIA DYLANDA
Sbjct  90   LIQKLKDKGVDVDHIIELIHQIFNIVRDTRGLPEDLQDFLALIPTDQVLAIAADYLANDA 149
Query  121  EVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPFVPP 180
            EV+  V YL+SD+F  I+ T+++LPEF NF NFL+ +GL+   ++N IH ++G+P     
Sbjct  150  EVKAAVEYLKSDEFETIVVTVDSLPEFKNFLNFLQTNGLNAIEFLNNIHDLLGIPHIPVT 209
Query  181  SRRHARRG 188
             R+H RRG
Sbjct  210  GRKHLRRG 217

Sequence Alignment: 7. Allergen Name: Bla g 1.0101 Sequence ID: AAD13530

 Score = 226.5 bits 965,  Expect = 1e-60
 Identities = 200/272 73%, Positives = 236/272 86%, Gaps = 6/272 2%
Query  1    VGVDGLIDDIIAILPIDDLKALFQEKLETSLDFKAFYDAVRSPEFQSIVQTLNAMPEYQD 60
            VG+ GLIDD++AILPI+DLKALF EKLETS DF A+Y+A+RSPEFQSIVQTLNAMPEYQ+
Sbjct  134  VGITGLIDDVLAILPIEDLKALFNEKLETSPDFLALYNAIRSPEFQSIVQTLNAMPEYQN 193
Query  61   LLQKLRDKGVDVDHYIELIRALFGLT---REARNLQDDLNDFLALIPTDQILAIAMDYLA 117
            LLQKLR+KGVDVD  IELIRALFGLT   + +RNLQDDL DFLALIP DQI+AIA DYLA
Sbjct  194  LLQKLREKGVDVDKIIELIRALFGLTLNGKASRNLQDDLQDFLALIPVDQIIAIATDYLA 253
Query  118  NDAEVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPPF 177
            NDAEVQ  VAYLQSD+F  I+ T++ALPE+ NF NFL+ +GL+  +++N IH ++G+P  
Sbjct  254  NDAEVQAAVAYLQSDEFETIVVTLDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIP-H 312
Query  178  VPPSRR--HARRGVGINGLIDDVIAILPVDELKTLFQEKLETSPDFKALYDAIRSPEFQS 235
            +P S R  H RRGVGI GLIDDV+AILP+D+LK LF EKLETSPDF ALY+AI+SPEFQS
Sbjct  313  IPVSGRKYHIRRGVGITGLIDDVLAILPLDDLKALFNEKLETSPDFLALYNAIKSPEFQS 372
Query  236  IISTLNAMPEYQELLQNLRDKGVDVDHFIELIRSWFGL 273
            I+ TLNAMPEYQ LL+ LR+KGVDVD  IELIR+ FGL
Sbjct  373  IVQTLNAMPEYQNLLEKLREKGVDVDKIIELIRALFGL 410
 Score = 126.6 bits 527,  Expect = 1e-30
 Identities = 84/128 65%, Positives = 105/128 82%, Gaps = 6/128 4%
Query  60   DLLQKLRDKGVDVDHYIELIRALFGLT---REARNLQDDLNDFLALIPTDQILAIAMDYL 116
            +LL+KLR+KGVDVD  IELIRALFGLT   + +RNLQDDL DFLALIP DQI+AIA DYL
Sbjct  1    NLLEKLREKGVDVDKIIELIRALFGLTLNAKASRNLQDDLQDFLALIPVDQIIAIATDYL 60
Query  117  ANDAEVQELVAYLQSDDFHKIINTIEALPEFANFYNFLKGHGLDVANYINEIHSIIGLPP 176
            ANDAEVQ  VAYLQSD+F  I+  ++ALPE+ NF NFL+ +GL+  +++N IH ++G+P 
Sbjct  61   ANDAEVQAAVAYLQSDEFETIVVALDALPELQNFLNFLEANGLNAIDFLNGIHDLLGIP- 119
Query  177  FVPPSRR--HARRG 188
             +P S R  H RRG
Sbjct  120  HIPVSGRKYHIRRG 133

Sequence Alignment: 8. Allergen Name: Bla g 1.0103 Sequence ID: AAD13532

 Score = 198.5 bits 841,  Expect = 1e-52
 Identities = 129/184 70%, Positives = 155/184 84%, Gaps = 3/184 1%
Query  89   ARNLQDDLNDFLALIPTDQILAIAMDYLANDAEVQELVAYLQSDDFHKIINTIEALPEFA 148
            +RNLQDDL DFLALIP DQI+AIA DYLANDAEVQ  VAYLQSD+F  I+ T++ALPE+ 
Sbjct  1    SRNLQDDLQDFLALIPVDQIIAIATDYLANDAEVQAAVAYLQSDEFETIVVTLDALPELQ 60
Query  149  NFYNFLKGHGLDVANYINEIHSIIGLPPFVPPSRR--HARRGVGINGLIDDVIAILPVDE 206
            NF NFL+ +GL+  +++N IH ++G+P  +P S R  H RRGVGI GLIDDV+AILP+D+
Sbjct  61   NFLNFLEANGLNAIDFLNGIHDLLGIP-HIPVSGRKYHIRRGVGITGLIDDVLAILPLDD 119
Query  207  LKTLFQEKLETSPDFKALYDAIRSPEFQSIISTLNAMPEYQELLQNLRDKGVDVDHFIEL 266
            LK LF EKLETSPDF ALY+AI+SPEFQSI+ TLNAMPEYQ LL+ LR+KGVDVD  IEL
Sbjct  120  LKALFNEKLETSPDFLALYNAIKSPEFQSIVQTLNAMPEYQNLLEKLREKGVDVDKIIEL 179
Query  267  IRSWFGL 273
            IR+ FGL
Sbjct  180  IRALFGL 186

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.