The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAA
DNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDM
NYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSS
PVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIR
SDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF72989 Ory s 1 271 1900 414.2 2.5e-117
AAF72985 Ory s 1 286 1301 286.3 8.2e-79
AAF72987 Ory s 1 275 1274 280.5 4.3e-77
AAF72984 Ory s 1 268 1221 269.2 1.1e-73
AAF72988 Ory s 1 327 1174 259.2 1.4e-70
AAB61710 Ory s 1 261 1094 242.1 1.5e-65
AAD10496 Tri a ps93 271 998 221.6 2.3e-59
AAF72990 Ory s 1 269 996 221.2 3.1e-59
P58738 Zea m 1 269 990 219.9 7.5e-59
ACA23876 Pas n 1.0101 265 961 213.7 5.4e-57
AAF72991 Ory s 1 267 961 213.7 5.4e-57
AAF72983 Ory s 1 267 930 207.1 5.3e-55
A0A4D6G2J8 Uro m 1.0201 229 897 200.1 5.9e-53
P43213 Phl p 1 263 894 199.4 1.1e-52
CAA81613 Phl p 1.0101 263 885 197.5 4.1e-52
CAA10520 Poa p a 263 884 197.3 4.7e-52
CAA10140 Hol l 1 263 883 197.1 5.5e-52
CAB63699 Lol p 1.0103 263 877 195.8 1.3e-51
AAA63278 Lol p 1.0102 252 875 195.4 1.7e-51
CAA93121 Hol l 1.0102 248 872 194.7 2.6e-51
AAA63279 Lol p 1.0101 263 871 194.5 3.2e-51
P43216 Hol l 1 265 871 194.5 3.3e-51
P14946 Lol p 1 263 865 193.2 7.8e-51
QCX36431 Zoy m 1.0101 272 864 193.0 9.4e-51
Q41260 Pha a 1 269 863 192.8 1.1e-50
AAF80379 Cyn d 1.0204 244 853 190.7 4.3e-50
AAK96255 Cyn d 1.0201 244 852 190.5 4.9e-50
AAL14077 Cyn d 1.0202 262 852 190.5 5.3e-50
AAL14079 Cyn d 1.0203 262 852 190.5 5.3e-50
A0A4D6FZ45 Uro m 1.0101 262 852 190.5 5.3e-50
AAL14078 Cyn d 1 262 851 190.2 6.2e-50
O04701 Cyn d 1 246 828 185.4 1.7e-48
ABC58726 Sor h 1.0101 239 821 183.9 4.7e-48
AAA50175 Gly m 2 277 816 182.8 1.2e-47
AAF72986 Ory s 1 275 797 178.7 1.9e-46
Q07154 Zea m 1 191 782 175.6 1.2e-45
Q40638 Ory s 1 263 768 172.5 1.3e-44
CAB37496 Ara t expansin 265 432 100.8 5.3e-23
AAG13596 Ory s 1 275 369 87.3 6.2e-19
BAA85432 Ory s 1 284 368 87.1 7.4e-19
CAA10346 Cyn d 2 122 222 56.1 6.9e-10
CAA10345 Dac g 2 122 220 55.7 9.3e-10
CAA10348 Poa p 2 122 220 55.7 9.3e-10
P43214 Phl p 2 122 220 55.7 9.3e-10
P14947 Lol p 2 97 192 49.7 4.5e-08
P93124 Dac g 3 96 176 46.3 4.8e-07
CAA51775 Lol p 2 88 173 45.7 6.8e-07
2JNZ_A Phl p 3.0101 108 169 44.8 1.5e-06
AAP80171 Cyn d 15 112 164 43.7 3.4e-06
CAA90746 Tri a 3 118 137 38.0 0.00019
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 414.2 bits 1900,  Expect = 2e-117
 Identities = 271/271 100%, Positives = 271/271 100%, Gaps = 0/271 0%
Query  1    VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAA 60
            VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAA
Sbjct  1    VGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAA 60
Query  61   DNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDM 120
            DNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDM
Sbjct  61   DNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDM 120
Query  121  NYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSS 180
            NYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSS
Sbjct  121  NYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSS 180
Query  181  PVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIR 240
            PVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIR
Sbjct  181  PVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIR 240
Query  241  SDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS 271
            SDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS
Sbjct  241  SDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS 271

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 286.3 bits 1301,  Expect = 8e-79
 Identities = 177/245 72%, Positives = 207/245 84%, Gaps = 4/245 1%
Query  26   GEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQ 85
            G G  +N S+A      W  A+ATWYGQPNGAG  DNGGACGFK  NQYPFM MTSCGNQ
Sbjct  38   GNGWDFNSSDAAVYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQ 97
Query  86   PLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGR 145
            PL+K GKGCGSCY++RC ++ +CSG ++TV ITDMNY+P++ +HFDLSG AFGRLAKPG 
Sbjct  98   PLFKDGKGCGSCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGL 157
Query  146  ADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEA 205
             D LR +GIID++F RVPCEFPGLK+GFHVEE S+PVY+AVLVEYE+GDGDV QVDL E+
Sbjct  158  NDKLRHSGIIDIEFTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMES 217
Query  206  ----GAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNT 261
                G   G+WTPMRESWGS+WRLD+NHRL+APFSIRIR++SGKTLVA +VIP NW PNT
Sbjct  218  KTAHGPPTGKWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNT 277
Query  262  FYRSFVQYS 270
            FYRSFVQYS
Sbjct  278  FYRSFVQYS 286

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 280.5 bits 1274,  Expect = 4e-77
 Identities = 178/260 68%, Positives = 212/260 81%, Gaps = 10/260 3%
Query  5    VYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAADNGG 64
            +  +L VLVV   CKG          YN S+A    + W  A+ATWYG P GAG  DNGG
Sbjct  12   ILAILSVLVVHGSCKGHPVN------YNVSDASAYGSGWLPARATWYGAPTGAGPDDNGG 65
Query  65   ACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFP 124
            ACGFK VNQYPF  MTSCGN+P++K GKGCGSCY++RCN++P+CSGN +TV ITDMNY+P
Sbjct  66   ACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYP 125
Query  125  LSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYL 184
            +++YHFDLSG AFG +AKPG  D LR +GIID+QF RVPC +PGLK+ FHVEEGS+PVY+
Sbjct  126  VARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYF 185
Query  185  AVLVEYENGDGDVAQVDLKEA----GAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIR 240
            AVLVEYE+ DGDV QVDL E+    G   G WTPMRESWGS+WRLDSNHRL+APFS+RIR
Sbjct  186  AVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIR 245
Query  241  SDSGKTLVAPDVIPLNWTPNTFYRSFVQYS 270
            SDSGKTLVA +VIP NW+PN+ YRS VQ+S
Sbjct  246  SDSGKTLVANNVIPANWSPNSNYRSIVQFS 275

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 269.2 bits 1221,  Expect = 1e-73
 Identities = 166/227 73%, Positives = 189/227 83%, Gaps = 2/227 0%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W  A+ATWYG P GAG  D+GGACGFK  NQYPF  MTSCGN+P++K GKGCGSCY++RC
Sbjct  42   WEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRC 101
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
              +PACSGN +TV ITDMNY+P+S+YHFDLSG AFG +AKPG+ D LR AGIID+QF RV
Sbjct  102  VNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRV 161
Query  163  PCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSV 222
            PC FPGLKV FHVEEGS+PVY+AVLVEYE+GDGDV QVDL EA +    WTPMRESWGS+
Sbjct  162  PCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQS--WTPMRESWGSI 219
Query  223  WRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS 271
            WRLDSNHRL APFS+RI ++SGK LVA  VIP NW P   YRSFVQYSS
Sbjct  220  WRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQYSS 268

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 259.2 bits 1174,  Expect = 1e-70
 Identities = 162/246 65%, Positives = 193/246 78%, Gaps = 8/246 3%
Query  24   VQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCG 83
            +   G   +   + GG   W NA+ATWYG PNGAG  DNGGACGFK VN  PF  MTSCG
Sbjct  73   IPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCG 132
Query  84   NQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKP 143
            N+PL+K GKGCGSCY++RC  +PACSG  +TV ITDMNY+P+S YHFDLSG AFG +AK 
Sbjct  133  NEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKD 192
Query  144  GRADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLK 203
             R D+LR AGIID+QF RVPC++PGL V FHVE+GS+PVY+A+LVEYENGDGDV QVDL 
Sbjct  193  NRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLM 252
Query  204  EA--GAGG------GRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPL 255
            E+    GG      G WTPMRESWGS+WRLD+NH L+ PFS+RI ++SGKTL+A  VIP 
Sbjct  253  ESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPA 312
Query  256  NWTPNTFYRSFVQY 269
            +W PNT Y S VQ+
Sbjct  313  DWQPNTVYSSIVQF 326

Sequence Alignment: 6. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 242.1 bits 1094,  Expect = 1e-65
 Identities = 149/227 65%, Positives = 179/227 78%, Gaps = 3/227 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W  AKATWYGQPNGAG  DNGGACGFK  NQYPFM MTSCGN+PL++ GKGCG+CY++RC
Sbjct  31   WLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRC 90
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
              NP+CSG  +TV ITDMNY+P+++YHFDLSG AFG +A+PG  D LR AGIID+QF RV
Sbjct  91   TNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRV 150
Query  163  PCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGR---WTPMRESW 219
            PC   GL V FHVE GS+PVYLAVLVE+ N DG V Q+D+ E+   G     WTPMR SW
Sbjct  151  PCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSW 210
Query  220  GSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269
            GS+WRLD+NHRL+ P S+R+ S+SG+T++A  VIP NW  NT Y S VQ+
Sbjct  211  GSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 7. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 221.6 bits 998,  Expect = 2e-59
 Identities = 138/239 57%, Positives = 175/239 73%, Gaps = 4/239 1%
Query  31   YNESEAIGGAAAWGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKG 90
            Y+ + A    + W  AKATWYG PNGAG  DNGGACGFK VNQYP   M +CGN+P++ G
Sbjct  28   YDTAVARSYTSGWLPAKATWYGAPNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAG 87
Query  91   GKGCGSCYRVRC--NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADD 148
            G+GCG CY ++C  + NP+CSG  + + ITDMNY+P+++YH+DLSG AFG +AK G  D 
Sbjct  88   GEGCGMCYEIKCEYSNNPSCSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDR 147
Query  149  LRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAG 208
            LR AGIID+QF RVPC FPG+KV FHV+ GS+P YLAVLVEY N DG V +++L +   G
Sbjct  148  LRHAGIIDMQFRRVPCNFPGMKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNG 207
Query  209  --GGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSF 266
               G W  MR SWGSVWR+D+N  ++ PFSIRI SD+GKTLVA + IP  W  +  Y S 
Sbjct  208  RPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAYWSN 267
Query  267  VQY 269
            +Q+
Sbjct  268  LQF 270

Sequence Alignment: 8. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 221.2 bits 996,  Expect = 3e-59
 Identities = 136/227 59%, Positives = 174/227 76%, Gaps = 3/227 1%
Query  41   AAWGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRV 100
            A W  A+ATWYGQP G+G+ DNGGACG K VN  P+ GM SCGN P++K G+GCGSCY V
Sbjct  41   APWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEV 100
Query  101  RCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFA 160
            +C +  ACS    TV ITDMNY P+S YHFD+SG AFG +A PG+  +LR+AGIID+QF 
Sbjct  101  KCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFR 160
Query  161  RVPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESW 219
            RV C++PG  KV FHVE+GS+P YLAVLV++   DGDV Q+DL+EAG     W PM+ SW
Sbjct  161  RVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPA--WRPMKLSW 218
Query  220  GSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269
            G++WR+D+   L+APFSIR+ ++SGK+L+A DVIP+NW P+  Y S VQ+
Sbjct  219  GAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 9. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 219.9 bits 990,  Expect = 7e-59
 Identities = 141/259 54%, Positives = 180/259 69%, Gaps = 9/259 3%
Query  3    VVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAADN 62
            +VV  +L  LV    C       G     N +    G   W  A+ATWYGQPNGAGA DN
Sbjct  9    MVVGAVLAALVAGGSCGPPKVPPGP----NITTNYNG--KWLTARATWYGQPNGAGAPDN 62
Query  63   GGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNY 122
            GGACG K VN  P+ GMT+CGN P++K GKGCGSCY VRC   P CSGN  TV ITDMNY
Sbjct  63   GGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNY 122
Query  123  FPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFP-GLKVGFHVEEGSSP 181
             P++ YHFDLSG AFG LAKPG  D +R  GI+DV+F RV C++P G K+ FH+E+G +P
Sbjct  123  EPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNP 182
Query  182  VYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRS 241
             YLAVLV+Y   DGD+  +++++  +    W PM+ SWG++WR+D+   L+ PFSIR+ S
Sbjct  183  NYLAVLVKYVADDGDIVLMEIQDKLSA--EWKPMKLSWGAIWRMDTAKALKGPFSIRLTS 240
Query  242  DSGKTLVAPDVIPLNWTPNTFYRSFVQY 269
            +SGK ++A DVIP NW P+  Y S VQ+
Sbjct  241  ESGKKVIAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 10. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 213.7 bits 961,  Expect = 5e-57
 Identities = 141/257 54%, Positives = 178/257 69%, Gaps = 11/257 4%
Query  3    VVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAADN 62
            V V  +L  LV    C       G     N +    G   W  AKATWYGQPNGAG  DN
Sbjct  8    VAVAAVLAALVAGGSCGPPKVPPGP----NITTNYNG--KWLPAKATWYGQPNGAGPDDN 61
Query  63   GGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNY 122
            GGACG K VN  P+ G T+CGN P++K GKGCGSCY +RCN+ P CSG   TV ITDMNY
Sbjct  62   GGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCYEIRCNK-PECSGQPVTVFITDMNY 120
Query  123  FPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSP 181
             P++ YHFDLSG AFG +AKPG  D LR  GI D++F RV C++ G  K+ FHVE+GS+P
Sbjct  121  EPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNP 180
Query  182  VYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRS 241
             YLA+LV++   DGD+  ++LKE  +    W PM+ SWG++WR+D+   L  PFSIR+ S
Sbjct  181  NYLAMLVKFVADDGDIVLMELKEKSSD---WKPMKLSWGAIWRMDTPKALVPPFSIRLTS 237
Query  242  DSGKTLVAPDVIPLNWTPNTFYRSFVQY 269
            +SGK ++A DVIP+NW P+T Y S VQ+
Sbjct  238  ESGKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 11. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 213.7 bits 961,  Expect = 5e-57
 Identities = 126/224 56%, Positives = 171/224 76%, Gaps = 3/224 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W  A+ TWYG+P GAG  DNGGACG+K +++ PF+GM SCGN P++K GKGCGSC+ V+C
Sbjct  41   WLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKC 100
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
            ++  ACS     + ITDMN  P++ YHFDLSG AFG +AK G+ ++LR+AGIID+QF RV
Sbjct  101  SKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRV 160
Query  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++PG  KV FHVE+GS+P Y+AVLV+Y  GDGDV +V+LKE G+    W P+ ESWG+
Sbjct  161  RCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGS--EEWKPLNESWGA 218
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQ 268
            +WR+D+   L+ PFS+R+ ++S + LVA DVIP NW  N +Y+S +Q
Sbjct  219  IWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 207.1 bits 930,  Expect = 5e-55
 Identities = 117/224 52%, Positives = 167/224 74%, Gaps = 3/224 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W  AKATWYG P GAG  DNGGACG+K V++ PF+GM SCGN P++K GKGCGSC+ ++C
Sbjct  41   WLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC 100
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
            ++  ACS     + +TDMN  P++ YHFDLSG+AFG +AK G+ ++LR+AGIID QF RV
Sbjct  101  SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRV 160
Query  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P   K+ FH+E+ S+P YLA+LV+Y  GDGDV +V++KE G+    W  ++ESWG+
Sbjct  161  KCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGS--EEWKALKESWGA 218
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQ 268
            +WR+D+   L+ PFS+R+ ++ G+ ++A D IP  W  ++ Y+S VQ
Sbjct  219  IWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265

Sequence Alignment: 13. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 200.1 bits 897,  Expect = 6e-53
 Identities = 116/225 51%, Positives = 161/225 71%, Gaps = 3/225 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AKATWYG+P GAG  DNGGACG+K VN+ PF  M +CGN P++K G GCGSCY ++C
Sbjct  4    WLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEIKC 63
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
            ++   CSG    V ITD NY P++ YHFDL+G AFG +AK G  + LR+AGIID+QF RV
Sbjct  64   DKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRRV 123
Query  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P   K+ FHVE+G +P Y+A+L++Y  GDGD+  VD+KE G+    + P++ SWG+
Sbjct  124  KCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSE--EFIPLKHSWGA 181
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269
            +WR+DS   ++ P ++R+ S+ G TLV  D IP  W  +T Y S +Q+
Sbjct  182  IWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 14. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 199.4 bits 894,  Expect = 1e-52
 Identities = 119/221 53%, Positives = 158/221 71%, Gaps = 3/221 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  41   WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC 100
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
             +  ACSG    V ITD N  P++ YHFDLSG AFG +AK G    LR AG +++QF RV
Sbjct  101  TKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRV 160
Query  163  PCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P G KV FHVE+GS+P YLA+LV+Y NGDGDV  VD+KE G    +W  ++ESWG+
Sbjct  161  KCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGK--DKWIELKESWGA 218
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRS 265
            +WR+D+  +L  PF++R  ++ G    A DVIP  W  +T Y S
Sbjct  219  IWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYES 262

Sequence Alignment: 15. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 197.5 bits 885,  Expect = 4e-52
 Identities = 117/221 52%, Positives = 157/221 71%, Gaps = 3/221 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P  AG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  41   WLDAKSTWYGKPTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC 100
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
             +  ACSG    V ITD N  P++ YHFDLSGIAFG +AK G    LR AG +++QF RV
Sbjct  101  TKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRV 160
Query  163  PCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P G KV FHVE+GS+P YLA+LV++  GDGDV  VD+KE G    +W  ++ESWG+
Sbjct  161  KCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVDIKEKGK--DKWIALKESWGA 218
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRS 265
            +WR+D+   L+ PF++R  ++ G    A DVIP  W  +T Y S
Sbjct  219  IWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVIPEGWKADTAYES 262

Sequence Alignment: 16. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 197.3 bits 884,  Expect = 5e-52
 Identities = 118/221 53%, Positives = 157/221 71%, Gaps = 3/221 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  41   WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKC 100
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
             +  +CSG    V ITD N  P++ YHFDLSG AFG +AK G    LR AG ++++F RV
Sbjct  101  TKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRV 160
Query  163  PCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             CE+P G KV FHVE+GS+P YLA+LV+Y  GDGDV  VD+KE G    +W  ++ESWGS
Sbjct  161  KCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAVDIKEKGK--DKWIELKESWGS 218
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRS 265
            +WR+D+  +L  PF++R  ++ G    A DVIP  W  +T Y S
Sbjct  219  IWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYAS 262

Sequence Alignment: 17. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 197.1 bits 883,  Expect = 5e-52
 Identities = 117/221 52%, Positives = 159/221 71%, Gaps = 3/221 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  41   WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKC 100
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
             +  +CSG    V ITD N  P++ YH+DLSG AFG +AK G    LR AG ++++F RV
Sbjct  101  TKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRV 160
Query  163  PCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             CE+P G KV FHVE+GS+P YLA+LV+Y +GDGDV  VD+KE G    +W  ++ESWG+
Sbjct  161  KCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGK--DKWIELKESWGA 218
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRS 265
            VWR+D+  +L  PF++R  ++ G  + A DVIP  W  +T Y S
Sbjct  219  VWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVIPEGWKADTAYES 262

Sequence Alignment: 18. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 195.8 bits 877,  Expect = 1e-51
 Identities = 116/219 52%, Positives = 156/219 71%, Gaps = 3/219 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  41   WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC 100
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
             +  +CSG A TV ITD N  P++ YHFDLSG AFG +AK G    LR AG +++QF RV
Sbjct  101  TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRV 160
Query  163  PCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P G K  FHVE+ S+P YLA+LV+Y +GDGDV  VD+KE G    +W  ++ESWG+
Sbjct  161  KCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD--KWIELKESWGA 218
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
            VWR+D+  +L  PF++R  ++ G      DVIP  W  +T Y
Sbjct  219  VWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 260

Sequence Alignment: 19. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 195.4 bits 875,  Expect = 2e-51
 Identities = 115/219 52%, Positives = 157/219 71%, Gaps = 3/219 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  30   WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC 89
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
             +  +CSG A TV ITD N  P++ YHFDLSG AFG +AK G   ++R AG +++QF RV
Sbjct  90   TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRV 149
Query  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P   K  FHVE+GS+P YLA+LV+Y +GDGDV  VD+KE G    +W  ++ESWG+
Sbjct  150  KCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKEKGKD--KWIELKESWGA 207
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
            VWR+D+  +L  PF++R  ++ G      DVIP  W  +T Y
Sbjct  208  VWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSY 249

Sequence Alignment: 20. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 194.7 bits 872,  Expect = 3e-51
 Identities = 116/221 52%, Positives = 159/221 71%, Gaps = 3/221 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  26   WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKC 85
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
            ++  +CSG   TV ITD N  P++ YHFDLSG AFG +AK G    LR AG ++++F RV
Sbjct  86   SKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRV 145
Query  163  PCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P G K  FHVE+GS+P YLA+LV+Y +GDGDV  VD+KE G    +W  ++ESWG+
Sbjct  146  KCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGK--DKWIELKESWGA 203
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRS 265
            VWR+D+  +L  PF++R  ++ G    A DVIP  W  +T Y +
Sbjct  204  VWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 247

Sequence Alignment: 21. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 194.5 bits 871,  Expect = 3e-51
 Identities = 115/219 52%, Positives = 157/219 71%, Gaps = 3/219 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  41   WLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC 100
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
             +  +CSG A TV ITD N  P++ YHFDLSG AFG +AK G   ++R AG +++QF RV
Sbjct  101  TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRV 160
Query  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P   K  FHVE+ S+P YLA+LV+Y +GDGDV  VD+KE G    +WT ++ESWG+
Sbjct  161  KCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD--KWTELKESWGA 218
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
            VWR+D+  +L  PF++R  ++ G      DVIP  W  +T Y
Sbjct  219  VWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 22. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 194.5 bits 871,  Expect = 3e-51
 Identities = 116/221 52%, Positives = 158/221 71%, Gaps = 3/221 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  43   WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKC 102
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
             +  +CSG   TV ITD N  P++ YHFDLSG AFG +AK G    LR AG ++++F RV
Sbjct  103  TKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRV 162
Query  163  PCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P G K  FHVE+GS+P YLA+LV+Y +GDGDV  VD+KE G    +W  ++ESWG+
Sbjct  163  KCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGK--DKWIELKESWGA 220
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRS 265
            VWR+D+  +L  PF++R  ++ G    A DVIP  W  +T Y +
Sbjct  221  VWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEA 264

Sequence Alignment: 23. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 193.2 bits 865,  Expect = 8e-51
 Identities = 114/219 52%, Positives = 156/219 71%, Gaps = 3/219 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  41   WLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKC 100
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
             +  +CSG A TV ITD N  P++ YHFDLSG AFG +AK G   ++R AG +++QF RV
Sbjct  101  TKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRV 160
Query  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P   K  FHVE+ S+P YLA+LV+Y +GDGDV  VD+KE G    +W  ++ESWG+
Sbjct  161  KCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD--KWIELKESWGA 218
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
            VWR+D+  +L  PF++R  ++ G      DVIP  W  +T Y
Sbjct  219  VWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSY 260

Sequence Alignment: 24. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 193.0 bits 864,  Expect = 9e-51
 Identities = 117/225 52%, Positives = 158/225 70%, Gaps = 4/225 1%
Query  43   WGNAKATWYGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVR 101
            W +AKAT+YG  P GA   D+GGACG+K V++ PF GMT CGN+P++K G GCGSC+ ++
Sbjct  46   WQDAKATFYGSNPRGAAPDDDGGACGYKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIK 105
Query  102  CNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFAR 161
            C     CS     + ITD NY  ++ YHFDLSG AFG +AK G+ D+LR+AG + +QF R
Sbjct  106  CKEPAECSDKPVLIRITDKNYEHIAAYHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRR 165
Query  162  VPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWG 220
            V CE+P   K+ FHVE+G +  YLA+LVEY  GDGD+  VD+K  G+    + PM+ SWG
Sbjct  166  VKCEYPSKTKITFHVEKGCNDNYLALLVEYAAGDGDIVAVDIKPKGSD--EFLPMKPSWG 223
Query  221  SVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269
            ++WR+D    L+ PF++R+ S+SG  LV  DVIP +W PNT Y S +QY
Sbjct  224  AIWRIDPKKPLKGPFTVRLTSESGAKLVQEDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 25. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 192.8 bits 863,  Expect = 1e-50
 Identities = 113/217 52%, Positives = 158/217 72%, Gaps = 3/217 1%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W +AK+TWYG+P GAG  DNGGACG+K V++ PF GMT CGN P++K G+GCGSC+ ++C
Sbjct  47   WLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKC 106
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
            ++  +CSG   TV ITD N  P++ YHFDLSG AFG +AK G  +++R AG +++QF RV
Sbjct  107  SKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRV 166
Query  163  PCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P G K  FHVE+GS+P YLA+LV+Y +GDGDV  VD+KE G    +W  ++ESWG+
Sbjct  167  KCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGK--DKWIELKESWGA 224
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNT 261
            +WR+D+  +L  PF++R  ++ G      DVIP  W  +T
Sbjct  225  IWRIDTPDKLTGPFTVRYTTEGGTKAEFEDVIPEGWKADT 264

Sequence Alignment: 26. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 190.7 bits 853,  Expect = 4e-50
 Identities = 116/225 51%, Positives = 159/225 70%, Gaps = 4/225 1%
Query  43   WGNAKATWYGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVR 101
            W +AKAT+YG  P GA   D+GGACG+K V++ PF GMT CGN+P++K G  CGSCY ++
Sbjct  18   WLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK 77
Query  102  CNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFAR 161
            C     CSG    + ITD NY  ++ YHFDLSG AFG +AK G  D LR+AG + +QF R
Sbjct  78   CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRR 137
Query  162  VPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWG 220
            V CE+P   K+ FHVE+GSSP YLA+LV+Y  GDG++  VD+K  G+    + PM++SWG
Sbjct  138  VKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD--EFLPMKQSWG 195
Query  221  SVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269
            ++WR+D    L+ PF+IR+ S+SG  +   DVIP +W P+T Y+S +Q+
Sbjct  196  AIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 27. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 190.5 bits 852,  Expect = 5e-50
 Identities = 116/225 51%, Positives = 159/225 70%, Gaps = 4/225 1%
Query  43   WGNAKATWYGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVR 101
            W +AKAT+YG  P GA   D+GGACG+K V++ PF GMT CGN+P++K G  CGSCY ++
Sbjct  18   WLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK 77
Query  102  CNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFAR 161
            C     CSG    + ITD NY  ++ YHFDLSG AFG +AK G  D LR+AG + +QF R
Sbjct  78   CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRR 137
Query  162  VPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWG 220
            V CE+P   K+ FHVE+GSSP YLA+LV+Y  GDG++  VD+K  G+    + PM++SWG
Sbjct  138  VKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD--EFLPMKQSWG 195
Query  221  SVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269
            ++WR+D    L+ PF+IR+ S+SG  +   DVIP +W P+T Y+S +Q+
Sbjct  196  AIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 28. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 190.5 bits 852,  Expect = 5e-50
 Identities = 120/257 46%, Positives = 171/257 66%, Gaps = 6/257 2%
Query  9    LLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQ-PNGAGAADNGGACG 67
            ++ +V+     G+    G+    N +   G    W +AKAT+YG  P GA   D+GGACG
Sbjct  4    VVAVVLASMVGGALCAMGDKPGPNITATYGDK--WLDAKATFYGSDPRGAAPDDHGGACG 61
Query  68   FKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQ 127
            +K V++ PF GMT CGN+P++K G  CGSCY ++C     CSG    + ITD NY  ++ 
Sbjct  62   YKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
Query  128  YHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAV 186
            YHFDLSG AFG +AK G  D LR+AG + +QF RV CE+P   K+ FHVE+GS+P YLA+
Sbjct  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
Query  187  LVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKT 246
            LV+Y  GDG++  VD+K  G+    + PM++SWG++WR+D    L+ PF+IR+ S+SG  
Sbjct  182  LVKYAAGDGNIVSVDIKSKGS--DEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGH 239
Query  247  LVAPDVIPLNWTPNTFYRSFVQY 269
            +   DVIP +W P+T Y+S +Q+
Sbjct  240  VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 29. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 190.5 bits 852,  Expect = 5e-50
 Identities = 120/257 46%, Positives = 171/257 66%, Gaps = 6/257 2%
Query  9    LLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQ-PNGAGAADNGGACG 67
            ++ +V+     G+    G+    N +   G    W +AKAT+YG  P GA   D+GGACG
Sbjct  4    VVAVVLASMVGGALCAMGDKPGPNITATYGDK--WLDAKATFYGSDPRGAAPDDHGGACG 61
Query  68   FKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQ 127
            +K V++ PF  MT CGN+P++K G GCGSCY ++C     CSG    + ITD NY  ++ 
Sbjct  62   YKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
Query  128  YHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAV 186
            YHFDLSG AFG +AK G  D LR+AG + +QF RV CE+P   K+ FHVE+GS+P YLA+
Sbjct  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
Query  187  LVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKT 246
            LV+Y  GDG++  VD+K  G+    + PM++SWG++WR+D    L+ PF+IR+ S+SG  
Sbjct  182  LVKYAAGDGNIVSVDIKSKGS--DEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGH 239
Query  247  LVAPDVIPLNWTPNTFYRSFVQY 269
            +   DVIP +W P+T Y+S +Q+
Sbjct  240  VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 30. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 190.5 bits 852,  Expect = 5e-50
 Identities = 120/257 46%, Positives = 171/257 66%, Gaps = 6/257 2%
Query  9    LLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQ-PNGAGAADNGGACG 67
            ++ +V+     G+    G+    N +   G    W +AKAT+YG  P GA   D+GGACG
Sbjct  4    VVAVVLASMVGGALCAMGDKPGPNITATYGDK--WLDAKATFYGSDPRGAAPDDHGGACG 61
Query  68   FKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQ 127
            +K V++ PF  MT CGN+P++K G GCGSCY ++C     CSG    + ITD NY  ++ 
Sbjct  62   YKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
Query  128  YHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPG-LKVGFHVEEGSSPVYLAV 186
            YHFDLSG AFG +AK G  D LR+AG + +QF RV CE+P   K+ FHVE+GS+P YLA+
Sbjct  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
Query  187  LVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKT 246
            LV+Y  GDG++  VD+K  G+    + PM++SWG++WR+D    L+ PF+IR+ S+SG  
Sbjct  182  LVKYAAGDGNIVSVDIKSKGS--DEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGH 239
Query  247  LVAPDVIPLNWTPNTFYRSFVQY 269
            +   DVIP +W P+T Y+S +Q+
Sbjct  240  VEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 31. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 190.2 bits 851,  Expect = 6e-50
 Identities = 117/225 52%, Positives = 159/225 70%, Gaps = 4/225 1%
Query  43   WGNAKATWYGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVR 101
            W +AKAT+YG  P GA   D+GGACG+K V++ PF GMT CGN+P++K G GCGSCY ++
Sbjct  36   WLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIK 95
Query  102  CNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFAR 161
            C     CSG    + ITD NY  ++ YHFDLSG AFG +AK G  D LR+AG + +QF R
Sbjct  96   CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRR 155
Query  162  VPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWG 220
            V CE+P   K+ FHVE+GSSP YLA+LV+Y  GDG++  VD+K  G+    + PM+ SWG
Sbjct  156  VKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD--VFLPMKLSWG 213
Query  221  SVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269
            ++WR+D    L+ PF+IR+ S+SG  +   DVIP +W P+T Y+S +Q+
Sbjct  214  AIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 32. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 185.4 bits 828,  Expect = 2e-48
 Identities = 114/227 50%, Positives = 158/227 69%, Gaps = 4/227 1%
Query  43   WGNAKATWYGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVR 101
            W  A+AT+YG  P GA   D+GGACG+K V++ PF GMT+CGN+P++K G GC +CY ++
Sbjct  18   WLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCRACYEIK 77
Query  102  CNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFAR 161
            C     CSG    V ITD NY  ++ YHFDLSG AFG +AK G+ D LR+AG + +QF R
Sbjct  78   CKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRR 137
Query  162  VPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWG 220
            V C++P G K+ FH+E+GS+  YLA+LV+Y  GDG++  VD+K   +    + PM+ SWG
Sbjct  138  VKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDS--DEFIPMKSSWG 195
Query  221  SVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS 271
            ++WR+D    L+ PFSIR+ S+ G  LV  DVIP NW P+T Y S +Q+ +
Sbjct  196  AIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA 246

Sequence Alignment: 33. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 183.9 bits 821,  Expect = 5e-48
 Identities = 117/226 51%, Positives = 161/226 71%, Gaps = 8/226 3%
Query  32   NESEAIGGAAAWGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGG 91
            N +E  G  + W   KATWYG+P GAG  DNGGACG+K VN+ PF  M +CGN P++K G
Sbjct  9    NITETYG--SDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKDG 66
Query  92   KGCGSCYRVRCNR-NPA-CSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDL 149
              CGSC+ ++C++  PA CSG A  V ITDMNY  ++ YHFDL+G AFG +AK G+ + L
Sbjct  67   L-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEKL 125
Query  150  RRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGG 209
             +AGIID++F RV C++ G KV FHVE+GS+P YLA+LV+Y +GDGD+  VD+KE G  G
Sbjct  126  AKAGIIDMKFRRVKCKY-GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEKG--G 182
Query  210  GRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
              + P++ SWG++WR DS   ++ P +++I ++ G      DVIP  W  +T Y
Sbjct  183  DAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTY 236

Sequence Alignment: 34. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 182.8 bits 816,  Expect = 1e-47
 Identities = 121/240 50%, Positives = 162/240 67%, Gaps = 7/240 2%
Query  29   RWYNESEAIGGAAAWGNAKATWYGQPNGAGAADNGGACGF-KKVNQYPFMGMTSCGNQPL 87
            + YN S     ++ W  A ATWYG  NG G+   GGACG+   V Q PF  + S G+  +
Sbjct  34   KLYNASYYSPSSSDWSPAVATWYGPANGDGS--EGGACGYGNAVGQPPFSSLISAGSPLI 91
Query  88   YKGGKGCGSCYRVRCNRNPACSGNAQTVAITD--MNYFPLSQYHFDLSGIAFGRLAKPGR 145
            Y  GKGCGSCY V+C  N ACSGN   V ITD        +QYHFDLSG AFG +A  G+
Sbjct  92   YDSGKGCGSCYEVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQ 151
Query  146  ADDLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEA 205
             ++LR AG I++Q  R+ C +PG  + FHV+ GS+  Y+A LVEYE+GDGD+A+V+LKEA
Sbjct  152  DENLRNAGKINIQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEA 211
Query  206  GAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRS-DSGKTLVAPDVIPLNWTPNTFYR 264
                G W  M++SWG+VW++D    LRAPFSI++ + +SG+T+VA +VIP  WTP   YR
Sbjct  212  -LDSGSWDSMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYR 270
Query  265  SFVQYSS 271
            S V +++
Sbjct  271  SIVNFAT 277

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 178.7 bits 797,  Expect = 2e-46
 Identities = 126/264 47%, Positives = 167/264 63%, Gaps = 13/264 4%
Query  2    GVVVYYLLLVLVVVQ-GCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPNGAGAA 60
            G  V+ +L+ L ++     G       GR    + ++G    W +  ATWYG P G G+ 
Sbjct  5    GTFVFAVLVALPILSLPVSGYEQNYTAGR--RSTMSLGRGYGWSSGGATWYGGPQGDGS- 61
Query  61   DNGGACGFKK-VNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITD 119
              GGACG++  V Q PF  M + G   L+K GKGCGSCY+++C  N ACSG   TV ITD
Sbjct  62   -EGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITD 120
Query  120  M--NYFPLSQY-HFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHVE 176
                   L++  HFD+SG AFG +A  G  D LR AG++ +Q+ RVPC F  + V F V+
Sbjct  121  SCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRF-AMNVAFKVD 179
Query  177  EGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSN--HRLRAP 234
             GS+P YLA+LV+Y NGDGD+A V + +A  GGG W  M++SWG+ WRL+SN    L  P
Sbjct  180  AGSNPYYLAILVQYANGDGDLAAVHIMKARGGGG-WKAMQQSWGATWRLNSNTGKPLSPP 238
Query  235  FSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS 271
            FSIR+ S SGK LVA +VIP  W     YRS V Y++
Sbjct  239  FSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA 275

Sequence Alignment: 36. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 175.6 bits 782,  Expect = 1e-45
 Identities = 104/189 55%, Positives = 140/189 74%, Gaps = 3/189 1%
Query  79   MTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFG 138
            MT+CGN P++K GKGCGSCY VRC   P CSGN  TV ITDMNY P++ YHFDLSG AFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  139  RLAKPGRADDLRRAGIIDVQFARVPCEFP-GLKVGFHVEEGSSPVYLAVLVEYENGDGDV 197
             LAKPG  D LR  GI+DV+F RV C++P G K+ FH+E+G +P Y+AVLV++   DGD+
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  198  AQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNW 257
              +++++  +    W PM+ SWG++WR+D+   L+ PFSIR+ S+SGK ++A D+IP NW
Sbjct  121  VLMEIQDKLS--AEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANW 178
Query  258  TPNTFYRSFVQY 269
             P+  Y S VQ+
Sbjct  179  RPDAVYTSNVQF 190

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 172.5 bits 768,  Expect = 1e-44
 Identities = 100/207 48%, Positives = 147/207 71%, Gaps = 6/207 2%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
            W  A+     +P      DNGGACG+K V++ PF+GM SCGN P++K GKGCGSC+ ++C
Sbjct  41   WLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKC 100
Query  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
            ++  ACS     + +TDMN  P++ YHFDLSG+A   +AK G+ ++LR+AGIID QF RV
Sbjct  101  SKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQFRRV 157
Query  163  PCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGS 221
             C++P   K+ FH+E+ S+P YLA+LV+Y  GDGDV +V++KE G+    W  ++ESWG+
Sbjct  158  KCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE--EWKALKESWGA 215
Query  222  VWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIP 254
            +WR+D+   L+ PFS+R+ ++  +   A D IP
Sbjct  216  IWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIP 248

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 100.8 bits 432,  Expect = 5e-23
 Identities = 79/216 36%, Positives = 123/216 56%, Gaps = 16/216 7%
Query  45   NAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNR 104
            ++KA ++     + +A + GAC +  +    F G  +     +YK G GCG+C++VRC +
Sbjct  28   SSKAAYFS----SASALSSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRC-K 82
Query  105  NPA-CSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKP--GRADDLRRAGIIDVQFAR 161
            NP  CS    TV +TD+N    +Q  + LS  AF  +AKP  G   DL + GI+D+++ R
Sbjct  83   NPTLCSSKGTTVIVTDLN--KTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRR 140
Query  162  VPCEFPGLKVGFHVEEGS-SPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWG 220
            VPC++   K+   VEE S +P YLA+ + Y+ G  +V  + +  A  G   W+ M  S G
Sbjct  141  VPCDYGNKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYI--AQVGSSHWSYMTRSHG 198
Query  221  SVWRLDS--NHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQYS 270
            +VW  D   N  L+  F +    D GK + +  V+P NW     Y + VQ +
Sbjct  199  AVWVTDKVPNGALQFRFVVTAGYD-GKMVWSQRVLPANWEAGKSYDAGVQIT 249

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 87.3 bits 369,  Expect = 6e-19
 Identities = 67/204 32%, Positives = 103/204 50%, Gaps = 11/204 5%
Query  60   ADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTVAITD 119
            A N G+CG+  +      G  +  +  L++GG GCG+C++VRC     CS     V +TD
Sbjct  48   ALNAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD 107
Query  120  MNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFP-GLKVGFHVEEG 178
                  ++  + LS  A+  +A+PG A  LR    +DV++ RVPCE+  G  +   VEE 
Sbjct  108  EAR-STNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEK 166
Query  179  SSPVY-LAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPFSI 237
            S P   L++   Y+ G  D+  VD+  A  G   W  M   +G  W   + +    P+  
Sbjct  167  SRPPRELSIRFLYQGGQTDIVAVDV--ATVGSSNWKFMTRDYGPAW--STAQAPAGPLQF 222
Query  238  RIRSDSG---KTLVAP-DVIPLNWTPNTFYRSFVQ 268
            R+    G   K + A  +V+P  WT    Y + VQ
Sbjct  223  RVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 87.1 bits 368,  Expect = 7e-19
 Identities = 74/208 35%, Positives = 116/208 55%, Gaps = 33/208 15%
Query  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGM-TSCGNQPLYKGGKGCGSCYRVR 101
            W +  AT+YG P+G G  D GGACG+   +   +    T+  + PL+  G GCG CY +R
Sbjct  52   WHDGSATFYGDPSGMGD-DFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCYELR 110
Query  102  CNRNPACSGNAQTVAITDMNYFPLSQY--------------HFDLSGIAFGRLAKPGRAD 147
            C ++P C+  + +V IT  N  P + Y              HFD++  +F +LA+     
Sbjct  111  CVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ----- 165
Query  148  DLRRAGIIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGA 207
              R AGI+ VQ+ RVPC+  G   G       +  +L + V    G GDV+ + +K +G 
Sbjct  166  --RVAGIVPVQYRRVPCQRTG---GVRFCLQGNHYWLLLYVMNVGGAGDVSSLSVKTSG- 219
Query  208  GGGRWTPMRESWGSVWR----LDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
            GGG W     +WG  ++    LD++  L   ++    S   +T++  D I   W     Y
Sbjct  220  GGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTT--YSTPQQTIIVSDAISPWWITGLCY 277
Query  264  R 264
            +
Sbjct  278  Q 278

Sequence Alignment: 41. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 56.1 bits 222,  Expect = 7e-10
 Identities = 43/103 41%, Positives = 62/103 60%, Gaps = 7/103 6%
Query  154  IIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWT 213
            ++   FA   C  P  KV F VE+GS+  +LAVLV+YE GD  +A+V+L+E G+    W 
Sbjct  16   VLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSD--EWV 68
Query  214  PMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
             M +  G VW +DS   L+ PF+ R  ++ G   V  DV+P  +T    Y
Sbjct  69   AMTKGEGGVWTFDSEEPLKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 55.7 bits 220,  Expect = 9e-10
 Identities = 43/103 41%, Positives = 62/103 60%, Gaps = 7/103 6%
Query  154  IIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWT 213
            ++   FA   C  P  KV F VE+GS+  +LAVLV+YE GD  +A+V+L+E G+    W 
Sbjct  16   VLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSD--EWV 68
Query  214  PMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
             M +  G VW +DS   L+ PF+ R  ++ G   V  DV+P  +T    Y
Sbjct  69   AMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 55.7 bits 220,  Expect = 9e-10
 Identities = 43/103 41%, Positives = 62/103 60%, Gaps = 7/103 6%
Query  154  IIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWT 213
            ++   FA   C  P  KV F VE+GS+  +LAVLV+YE GD  +A+V+L+E G+    W 
Sbjct  16   VLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSD--EWV 68
Query  214  PMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
             M +  G VW +DS   L+ PF+ R  ++ G   V  DV+P  +T    Y
Sbjct  69   AMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 55.7 bits 220,  Expect = 9e-10
 Identities = 43/103 41%, Positives = 62/103 60%, Gaps = 7/103 6%
Query  154  IIDVQFARVPCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWT 213
            ++   FA   C  P  KV F VE+GS+  +LAVLV+YE GD  +A+V+L+E G+    W 
Sbjct  16   VLAALFAGAWC-VP--KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSD--EWV 68
Query  214  PMRESWGSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
             M +  G VW +DS   L+ PF+ R  ++ G   V  DV+P  +T    Y
Sbjct  69   AMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 49.7 bits 192,  Expect = 5e-08
 Identities = 34/91 37%, Positives = 56/91 61%, Gaps = 4/91 4%
Query  171  VGFHVEEGSSPVYLAVLVEYENGDGD-VAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNH 229
            V F VE+GS    LA+ ++Y N +GD +A+V+LKE G+    W  ++++   VW + S+ 
Sbjct  4    VEFTVEKGSDEKNLALSIKY-NKEGDSMAEVELKEHGSN--EWLALKKNGDGVWEIKSDK 60
Query  230  RLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYR 264
             L+ PF+ R  S+ G   V  DV+P ++   T Y+
Sbjct  61   PLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 46. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 46.3 bits 176,  Expect = 5e-07
 Identities = 31/92 33%, Positives = 51/92 55%, Gaps = 3/92 3%
Query  169  LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSN 228
            +KV F VE+GS P  L + ++Y      +A+V+L++ G+    W P+ +  G++W + S+
Sbjct  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGS--EEWEPLTKK-GNLWEVKSS 57
Query  229  HRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
              L  PF+ R  S  G   V  +VIP  +   T Y
Sbjct  58   KPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 45.7 bits 173,  Expect = 7e-07
 Identities = 31/86 36%, Positives = 53/86 61%, Gaps = 4/86 4%
Query  173  FHVEEGSSPVYLAVLVEYENGDGD-VAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRL 231
            F VE+GS    LA+ ++Y + +GD +A+V+LKE G+    W  ++++   VW + S+  L
Sbjct  2    FTVEKGSDEKNLALSIKY-SKEGDAMAEVELKEHGSN--EWLALKKNGDGVWEIKSDKPL 58
Query  232  RAPFSIRIRSDSGKTLVAPDVIPLNWTPNT 261
            + PF+ R  S+ G   V  DV+P ++   T
Sbjct  59   KGPFNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 48. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 44.8 bits 169,  Expect = 2e-06
 Identities = 29/93 31%, Positives = 52/93 55%, Gaps = 3/93 3%
Query  169  LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSN 228
            ++V F V++GS P  L + ++Y      +A+V+L++ G+    W P+ +  G+VW + S+
Sbjct  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSE--EWEPLTKK-GNVWEVKSS 69
Query  229  HRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYR 264
              L  PF+ R  S  G   V  +VIP  ++    Y+
Sbjct  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 49. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 43.7 bits 164,  Expect = 3e-06
 Identities = 34/92 36%, Positives = 57/92 61%, Gaps = 9/92 9%
Query  169  LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSN 228
            + + FHVEE S    L++    ++   ++ QVD++E GA      PM +S G  W +D  
Sbjct  20   VNIIFHVEESSPKFALSI----KDSAKEITQVDVREHGADN--MDPMTKS-GDSWTIDKP 72
Query  229  HRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269
              L+ P++IR+R++ G + V  DVIP NW   T Y + +++
Sbjct  73   --LKGPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 50. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 38.0 bits 137,  Expect = 0.0002
 Identities = 25/92 27%, Positives = 49/92 53%, Gaps = 3/92 3%
Query  169  LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSN 228
            +KV + V++GS    LA+ ++Y   +  +++V+L++ G+    W P+ +  G VW +  +
Sbjct  23   VKVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGS--EEWQPLTKK-GDVWEVSCS 79
Query  229  HRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263
              L  PF+ R  S +G   V  +V   ++     Y
Sbjct  80   KPLVGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTY 114

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.