The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPL
TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE
Sequence Info Allergen Name Length Opt Bits Score E Value
P93124 Dac g 3 96 642 157.1 7.7e-41
2JNZ_A Phl p 3.0101 108 597 146.7 1.2e-37
P14948 Lol p 3 97 551 136.0 1.8e-34
CAA90746 Tri a 3 118 469 117.0 1.1e-28
P14947 Lol p 2 97 432 108.4 3.6e-26
CAA51775 Lol p 2 88 390 98.6 2.9e-23
CAA10345 Dac g 2 122 386 97.8 6.9e-23
P43214 Phl p 2 122 386 97.8 6.9e-23
CAA10348 Poa p 2 122 386 97.8 6.9e-23
CAA10346 Cyn d 2 122 386 97.8 6.9e-23
AAF72991 Ory s 1 267 263 69.6 4.7e-14
AAF72983 Ory s 1 267 259 68.7 9e-14
CAA10520 Poa p a 263 245 65.4 8.4e-13
P43213 Phl p 1 263 241 64.5 1.6e-12
A0A4D6G2J8 Uro m 1.0201 229 240 64.2 1.7e-12
Q40638 Ory s 1 263 239 64.0 2.2e-12
O04701 Cyn d 1 246 238 63.8 2.5e-12
AAA63279 Lol p 1.0101 263 237 63.5 3e-12
CAA10140 Hol l 1 263 235 63.1 4.2e-12
P14946 Lol p 1 263 234 62.9 4.9e-12
AAA63278 Lol p 1.0102 252 233 62.6 5.6e-12
Q41260 Pha a 1 269 232 62.4 6.9e-12
ABC58726 Sor h 1.0101 239 229 61.7 1e-11
CAA93121 Hol l 1.0102 248 229 61.7 1.1e-11
P43216 Hol l 1 265 229 61.7 1.1e-11
AAK96255 Cyn d 1.0201 244 227 61.2 1.4e-11
AAP80171 Cyn d 15 112 223 60.0 1.6e-11
AAL14079 Cyn d 1.0203 262 226 61.0 1.8e-11
A0A4D6FZ45 Uro m 1.0101 262 226 61.0 1.8e-11
AAL14077 Cyn d 1.0202 262 226 61.0 1.8e-11
CAA81613 Phl p 1.0101 263 225 60.8 2.1e-11
CAB63699 Lol p 1.0103 263 225 60.8 2.1e-11
AAF80379 Cyn d 1.0204 244 224 60.5 2.3e-11
QCX36431 Zoy m 1.0101 272 223 60.3 3e-11
AAL14078 Cyn d 1 262 209 57.1 2.7e-10
P58738 Zea m 1 269 209 57.1 2.8e-10
ACA23876 Pas n 1.0101 265 203 55.7 7.3e-10
Q07154 Zea m 1 191 200 54.8 9.3e-10
AAF72990 Ory s 1 269 191 52.9 5.1e-09
AAF72984 Ory s 1 268 189 52.4 6.9e-09
AAF72986 Ory s 1 275 185 51.5 1.3e-08
AAD10496 Tri a ps93 271 176 49.4 5.7e-08
AAF72989 Ory s 1 271 176 49.4 5.7e-08
AAB61710 Ory s 1 261 158 45.2 1e-06
A0A077B2S0 Sor h 2.0201 121 154 44.0 1.1e-06
AAF72987 Ory s 1 275 153 44.1 2.3e-06
AAA50175 Gly m 2 277 153 44.1 2.3e-06
Q41183 Dac g 2 36 142 40.7 3.1e-06
AAF72985 Ory s 1 286 149 43.2 4.5e-06
AAF72988 Ory s 1 327 139 40.9 2.5e-05
A0A077B7S9 Sor h 2.0101 119 134 39.3 2.7e-05
AAG13596 Ory s 1 275 109 33.9 0.0027
AAB23303 Dac g 2 26 92 29.0 0.0077
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 157.1 bits 642,  Expect = 8e-41
 Identities = 96/96 100%, Positives = 96/96 100%, Gaps = 0/96 0%
Query  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPL 60
            VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPL
Sbjct  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPL 60
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE 96
            TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE 96

Sequence Alignment: 2. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 146.7 bits 597,  Expect = 1e-37
 Identities = 87/96 90%, Positives = 91/96 94%, Gaps = 0/96 0%
Query  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPL 60
            V+VTF V+KGSDPKKLVLDIKYTRPGD+LAEVELRQHGSEEWEPLTKKGN+WEVKSSKPL
Sbjct  13   VQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKKGNVWEVKSSKPL 72
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE 96
             GPFNFRFMSKGGMRNVFDEVIPTAF IG TY PEE
Sbjct  73   VGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYKPEE 108

Sequence Alignment: 3. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 136.0 bits 551,  Expect = 2e-34
 Identities = 80/94 85%, Positives = 87/94 92%, Gaps = 0/94 0%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLT 61
            KV + VEKGSD K LVL+IKYTRPGDTLAEVELRQHGSEEWEP+TKKGNLWEVKS+KPLT
Sbjct  2    KVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKKGNLWEVKSAKPLT 61
Query  62   GPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPE 95
            GP NFRF+SKGGM+NVFDEVIPTAF +G TYTPE
Sbjct  62   GPMNFRFLSKGGMKNVFDEVIPTAFTVGKTYTPE 95

Sequence Alignment: 4. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 117.0 bits 469,  Expect = 1e-28
 Identities = 68/95 71%, Positives = 78/95 82%, Gaps = 0/95 0%
Query  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPL 60
            VKV + V+KGSD KKL L I YTRP D+L+EVELRQ+GSEEW+PLTKKG++WEV  SKPL
Sbjct  23   VKVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKKGDVWEVSCSKPL 82
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPE 95
             GPFNFRF+SK GM+ VFDEV  T FKIG TY PE
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTYEPE 117

Sequence Alignment: 5. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 108.4 bits 432,  Expect = 4e-26
 Identities = 61/93 65%, Positives = 74/93 79%, Gaps = 1/93 1%
Query  3    VTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGN-LWEVKSSKPLT 61
            V F VEKGSD K L L IKY + GD++AEVEL++HGS EW  L K G+ +WE+KS KPL 
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLK 63
Query  62   GPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPE 95
            GPFNFRF+S+ GMRNVFD+V+P  FK+GTTY PE
Sbjct  64   GPFNFRFVSEKGMRNVFDDVVPADFKVGTTYKPE 97

Sequence Alignment: 6. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 98.6 bits 390,  Expect = 3e-23
 Identities = 55/86 63%, Positives = 68/86 79%, Gaps = 1/86 1%
Query  5    FKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGN-LWEVKSSKPLTGP 63
            F VEKGSD K L L IKY++ GD +AEVEL++HGS EW  L K G+ +WE+KS KPL GP
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGP 61
Query  64   FNFRFMSKGGMRNVFDEVIPTAFKIGT 90
            FNFRF+S+ GM NVFD+V+P  FK+GT
Sbjct  62   FNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 7. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 97.8 bits 386,  Expect = 7e-23
 Identities = 56/93 60%, Positives = 73/93 78%, Gaps = 3/93 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTK-KGNLWEVKSSKPL 60
            KVTF VEKGS+ K L + +KY   GDT+AEVELR+HGS+EW  +TK +G +W   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE 96
             GPFNFRF+++ GM+NVFD+V+P  + IG TY PEE
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE 122

Sequence Alignment: 8. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 97.8 bits 386,  Expect = 7e-23
 Identities = 56/93 60%, Positives = 73/93 78%, Gaps = 3/93 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTK-KGNLWEVKSSKPL 60
            KVTF VEKGS+ K L + +KY   GDT+AEVELR+HGS+EW  +TK +G +W   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE 96
             GPFNFRF+++ GM+NVFD+V+P  + IG TY PEE
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE 122

Sequence Alignment: 9. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 97.8 bits 386,  Expect = 7e-23
 Identities = 56/93 60%, Positives = 73/93 78%, Gaps = 3/93 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTK-KGNLWEVKSSKPL 60
            KVTF VEKGS+ K L + +KY   GDT+AEVELR+HGS+EW  +TK +G +W   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE 96
             GPFNFRF+++ GM+NVFD+V+P  + IG TY PEE
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE 122

Sequence Alignment: 10. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 97.8 bits 386,  Expect = 7e-23
 Identities = 56/93 60%, Positives = 73/93 78%, Gaps = 3/93 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTK-KGNLWEVKSSKPL 60
            KVTF VEKGS+ K L + +KY   GDT+AEVELR+HGS+EW  +TK +G +W   S +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE 96
             GPFNFRF+++ GM+NVFD+V+P  + IG TY PEE
Sbjct  87   KGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE 122

Sequence Alignment: 11. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 69.6 bits 263,  Expect = 5e-14
 Identities = 38/94 40%, Positives = 59/94 62%, Gaps = 1/94 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            KVTF VEKGS+P  + + +KY      + +VEL++ GSEEW+PL +  G +W + + KPL
Sbjct  169  KVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPL 228
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPE 95
             GPF++R  ++   + V ++VIP  +K    Y  E
Sbjct  229  KGPFSLRVTTESDQKLVANDVIPDNWKANALYKSE 263

Sequence Alignment: 12. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 68.7 bits 259,  Expect = 9e-14
 Identities = 35/91 38%, Positives = 57/91 62%, Gaps = 1/91 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+TF +EK S+P  L L +KY      + EVE+++ GSEEW+ L +  G +W + + KPL
Sbjct  169  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 228
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
             GPF+ R  ++GG + + ++ IP  +K  + Y
Sbjct  229  KGPFSVRVTTEGGEKIIAEDAIPDGWKADSVY 260

Sequence Alignment: 13. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 65.4 bits 245,  Expect = 8e-13
 Identities = 39/90 43%, Positives = 59/90 65%, Gaps = 3/90 3%
Query  2    KVTFKVEKGSDPKKLVLDIKY-TRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            KVTF VEKGS+P  L L +KY T  GD +A V++++ G ++W  L +  G++W V +   
Sbjct  169  KVTFHVEKGSNPNYLALLVKYVTGDGDVVA-VDIKEKGKDKWIELKESWGSIWRVDTPDK 227
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            LTGPF  R+ ++GG +   ++VIP  +K  T Y
Sbjct  228  LTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 260

Sequence Alignment: 14. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 64.5 bits 241,  Expect = 2e-12
 Identities = 37/90 41%, Positives = 58/90 64%, Gaps = 3/90 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            KVTF VEKGS+P  L L +KY    GD +A V++++ G ++W  L +  G +W + +   
Sbjct  169  KVTFHVEKGSNPNYLALLVKYVNGDGDVVA-VDIKEKGKDKWIELKESWGAIWRIDTPDK 227
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            LTGPF  R+ ++GG +   ++VIP  +K  T+Y
Sbjct  228  LTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSY 260

Sequence Alignment: 15. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 64.2 bits 240,  Expect = 2e-12
 Identities = 37/92 40%, Positives = 53/92 57%, Gaps = 1/92 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+ F VEKG +P  + L IKY      +  V++++ GSEE+ PL    G +W + S KP+
Sbjct  132  KIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGAIWRIDSPKPI 191
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
             GP   R+ S+GG   V D+ IP  +K  T YT
Sbjct  192  KGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYT 224

Sequence Alignment: 16. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 64.0 bits 239,  Expect = 2e-12
 Identities = 33/82 40%, Positives = 52/82 63%, Gaps = 1/82 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+TF +EK S+P  L L +KY      + EVE+++ GSEEW+ L +  G +W + + KPL
Sbjct  166  KITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPL 225
Query  61   TGPFNFRFMSKGGMRNVFDEVIP 83
             GPF+ R  ++G  R+  ++ IP
Sbjct  226  KGPFSVRVTTEGARRSSAEDAIP 248

Sequence Alignment: 17. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 63.8 bits 238,  Expect = 2e-12
 Identities = 36/92 39%, Positives = 54/92 58%, Gaps = 1/92 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+TF +EKGS+   L L +KY      +  V+++   S+E+ P+    G +W +   KPL
Sbjct  147  KITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRIDPKKPL 206
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
             GPF+ R+ S+GG   V D+VIP  +K  T YT
Sbjct  207  KGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYT 239

Sequence Alignment: 18. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 63.5 bits 237,  Expect = 3e-12
 Identities = 35/91 38%, Positives = 59/91 64%, Gaps = 3/91 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            K TF VEK S+P  L + +KY    GD +A V++++ G ++W  L +  G +W + +   
Sbjct  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWTELKESWGAVWRIDTPDK 227
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
            LTGPF  R+ ++GG ++ F++VIP  +K  T+Y+
Sbjct  228  LTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYS 261

Sequence Alignment: 19. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 63.1 bits 235,  Expect = 4e-12
 Identities = 38/90 42%, Positives = 57/90 63%, Gaps = 3/90 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            KVTF VEKGS+P  L L +KY    GD +A V++++ G ++W  L +  G +W V +   
Sbjct  169  KVTFHVEKGSNPNYLALLVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPDK 227
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            LTGPF  R+ ++GG +   ++VIP  +K  T Y
Sbjct  228  LTGPFTVRYTTEGGTKVEAEDVIPEGWKADTAY 260

Sequence Alignment: 20. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 62.9 bits 234,  Expect = 5e-12
 Identities = 35/91 38%, Positives = 59/91 64%, Gaps = 3/91 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            K TF VEK S+P  L + +KY    GD +A V++++ G ++W  L +  G +W + +   
Sbjct  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPDK 227
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
            LTGPF  R+ ++GG ++ F++VIP  +K  T+Y+
Sbjct  228  LTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYS 261

Sequence Alignment: 21. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 62.6 bits 233,  Expect = 6e-12
 Identities = 35/91 38%, Positives = 59/91 64%, Gaps = 3/91 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            K TF VEKGS+P  L + +KY    GD +A V++++ G ++W  L +  G +W + +   
Sbjct  158  KPTFHVEKGSNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPDK 216
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
            LTGPF  R+ ++GG ++  ++VIP  +K  T+Y+
Sbjct  217  LTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS 250

Sequence Alignment: 22. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 62.4 bits 232,  Expect = 7e-12
 Identities = 36/88 40%, Positives = 56/88 63%, Gaps = 3/88 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            K TF VEKGS+P  L L +KY    GD +A V++++ G ++W  L +  G +W + +   
Sbjct  175  KPTFHVEKGSNPNYLALLVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAIWRIDTPDK 233
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGT 90
            LTGPF  R+ ++GG +  F++VIP  +K  T
Sbjct  234  LTGPFTVRYTTEGGTKAEFEDVIPEGWKADT 264

Sequence Alignment: 23. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 61.7 bits 229,  Expect = 1e-11
 Identities = 34/92 36%, Positives = 53/92 57%, Gaps = 1/92 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            KVTF VEKGS+P  L L +KY      +  V++++ G + ++PL    G +W   S  P+
Sbjct  145  KVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEKGGDAYQPLKHSWGAIWRKDSPDPI 204
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
              P   +  ++GG +  +D+VIP  +K  TTYT
Sbjct  205  KFPVTVQITTEGGTKTAYDDVIPEGWKADTTYT 237

Sequence Alignment: 24. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 61.7 bits 229,  Expect = 1e-11
 Identities = 37/90 41%, Positives = 56/90 62%, Gaps = 3/90 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            K TF VEKGS+P  L L +KY    GD +A V++++ G ++W  L +  G +W V +   
Sbjct  154  KPTFHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPDK 212
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            LTGPF  R+ ++GG +   ++VIP  +K  T Y
Sbjct  213  LTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 245

Sequence Alignment: 25. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 61.7 bits 229,  Expect = 1e-11
 Identities = 37/90 41%, Positives = 56/90 62%, Gaps = 3/90 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            K TF VEKGS+P  L L +KY    GD +A V++++ G ++W  L +  G +W V +   
Sbjct  171  KPTFHVEKGSNPNYLALLVKYIDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRVDTPDK 229
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            LTGPF  R+ ++GG +   ++VIP  +K  T Y
Sbjct  230  LTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAY 262

Sequence Alignment: 26. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 61.2 bits 227,  Expect = 1e-11
 Identities = 35/91 38%, Positives = 51/91 56%, Gaps = 1/91 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+ F VEKGS P  L L +KY      +  V+++  GS+E+ P+ +  G +W +   KPL
Sbjct  147  KIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRIDPPKPL 206
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
             GPF  R+ S+ G     D+VIP  +K  T Y
Sbjct  207  KGPFTIRLTSESGGHVEQDDVIPEDWKPDTVY 238

Sequence Alignment: 27. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 60.0 bits 223,  Expect = 2e-11
 Identities = 37/86 43%, Positives = 58/86 67%, Gaps = 6/86 6%
Query  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPL 60
            V + F VE+ S PK + L IK +     + +V++R+HG++  +P+TK G+ W +   KPL
Sbjct  20   VNIIFHVEESS-PK-FALSIKDS--AKEITQVDVREHGADNMDPMTKSGDSWTI--DKPL 73
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
             GP+N R+ ++GG   V D+VIP  +K GT Y
Sbjct  74   KGPLNIRLRAEGGGSRVQDDVIPENWKAGTDY 105

Sequence Alignment: 28. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 61.0 bits 226,  Expect = 2e-11
 Identities = 34/91 37%, Positives = 52/91 57%, Gaps = 1/91 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+ F VEKGS+P  L L +KY      +  V+++  GS+E+ P+ +  G +W +   KPL
Sbjct  165  KIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPL 224
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
             GPF  R+ S+ G     ++VIP  +K  T Y
Sbjct  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256

Sequence Alignment: 29. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 61.0 bits 226,  Expect = 2e-11
 Identities = 34/91 37%, Positives = 52/91 57%, Gaps = 1/91 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+ F VEKGS+P  L L +KY      +  V+++  GS+E+ P+ +  G +W +   KPL
Sbjct  165  KIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPL 224
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
             GPF  R+ S+ G     ++VIP  +K  T Y
Sbjct  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256

Sequence Alignment: 30. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 61.0 bits 226,  Expect = 2e-11
 Identities = 34/91 37%, Positives = 52/91 57%, Gaps = 1/91 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+ F VEKGS+P  L L +KY      +  V+++  GS+E+ P+ +  G +W +   KPL
Sbjct  165  KIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIKSKGSDEFLPMKQSWGAIWRIDPPKPL 224
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
             GPF  R+ S+ G     ++VIP  +K  T Y
Sbjct  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256

Sequence Alignment: 31. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 60.8 bits 225,  Expect = 2e-11
 Identities = 35/90 38%, Positives = 56/90 62%, Gaps = 3/90 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            KVTF VEKGS+P  L L +K+    GD +A V++++ G ++W  L +  G +W + + + 
Sbjct  169  KVTFHVEKGSNPNYLALLVKFVAGDGDVVA-VDIKEKGKDKWIALKESWGAIWRIDTPEV 227
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            L GPF  R+ ++GG +    +VIP  +K  T Y
Sbjct  228  LKGPFTVRYTTEGGTKGEAKDVIPEGWKADTAY 260

Sequence Alignment: 32. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 60.8 bits 225,  Expect = 2e-11
 Identities = 34/91 37%, Positives = 58/91 63%, Gaps = 3/91 3%
Query  2    KVTFKVEKGSDPKKLVLDIKYTR-PGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            K TF VEK S+P  L + +KY    GD +A V++++ G ++W  L +  G +W + +   
Sbjct  169  KPTFHVEKASNPNYLAILVKYVDGDGDVVA-VDIKEKGKDKWIELKESWGAVWRIDTPDK 227
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
            LTGPF  R+ ++GG ++  ++VIP  +K  T+Y+
Sbjct  228  LTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYS 261

Sequence Alignment: 33. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 60.5 bits 224,  Expect = 2e-11
 Identities = 35/91 38%, Positives = 51/91 56%, Gaps = 1/91 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+ F VEKGS P  L L +KY      +  V+++  GS+E+ P+ +  G +W +   KPL
Sbjct  147  KIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPL 206
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
             GPF  R+ S+ G     D+VIP  +K  T Y
Sbjct  207  KGPFTIRLTSESGGHVEQDDVIPEDWKPDTVY 238

Sequence Alignment: 34. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 60.3 bits 223,  Expect = 3e-11
 Identities = 34/92 36%, Positives = 53/92 57%, Gaps = 1/92 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+TF VEKG +   L L ++Y      +  V+++  GS+E+ P+    G +W +   KPL
Sbjct  175  KITFHVEKGCNDNYLALLVEYAAGDGDIVAVDIKPKGSDEFLPMKPSWGAIWRIDPKKPL 234
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
             GPF  R+ S+ G + V ++VIP  +K  T YT
Sbjct  235  KGPFTVRLTSESGAKLVQEDVIPADWKPNTAYT 267

Sequence Alignment: 35. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 57.1 bits 209,  Expect = 3e-10
 Identities = 34/91 37%, Positives = 50/91 54%, Gaps = 1/91 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+TF VEKGS P  L L +KY      +  V+++  GS+ + P+    G +W +   KPL
Sbjct  165  KITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDVFLPMKLSWGAIWRMDPPKPL 224
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
             GPF  R+ S+ G     ++VIP  +K  T Y
Sbjct  225  KGPFTIRLTSESGGHVEQEDVIPEDWKPDTVY 256

Sequence Alignment: 36. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 57.1 bits 209,  Expect = 3e-10
 Identities = 29/92 31%, Positives = 52/92 56%, Gaps = 1/92 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+ F +EKG +P  L + +KY      +  +E++   S EW+P+    G +W + ++K L
Sbjct  171  KIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 230
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
             GPF+ R+ S+ G + +  +VIP  ++    YT
Sbjct  231  KGPFSIRLTSESGKKVIAKDVIPANWRPDAVYT 263

Sequence Alignment: 37. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 55.7 bits 203,  Expect = 7e-10
 Identities = 30/90 33%, Positives = 52/90 57%, Gaps = 2/90 2%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+ F VEKGS+P  L + +K+      +  +EL++  S+ W+P+    G +W + + K L
Sbjct  169  KIVFHVEKGSNPNYLAMLVKFVADDGDIVLMELKEKSSD-WKPMKLSWGAIWRMDTPKAL 227
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
              PF+ R+ S+ G + +  +VIP  +K  T Y
Sbjct  228  VPPFSIRLTSESGKKVIAQDVIPVNWKPDTVY 259

Sequence Alignment: 38. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 54.8 bits 200,  Expect = 9e-10
 Identities = 26/92 28%, Positives = 52/92 56%, Gaps = 1/92 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            K+ F +EKG +P  + + +K+      +  +E++   S EW+P+    G +W + ++K L
Sbjct  93   KIVFHIEKGCNPNYVAVLVKFVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKAL 152
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
             GPF+ R+ S+ G + +  ++IP  ++    YT
Sbjct  153  KGPFSIRLTSESGKKVIAKDIIPANWRPDAVYT 185

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 52.9 bits 191,  Expect = 5e-09
 Identities = 28/91 30%, Positives = 49/91 53%, Gaps = 1/91 1%
Query  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
            KVTF VEKGS+P  L + +K+      + +++L++ G   W P+    G +W + ++ PL
Sbjct  171  KVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPL 230
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
              PF+ R  ++ G   +  +VIP  +     Y
Sbjct  231  KAPFSIRVTTESGKSLIAKDVIPVNWMPDAIY 262

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 52.4 bits 189,  Expect = 7e-09
 Identities = 29/92 31%, Positives = 54/92 58%, Gaps = 1/92 1%
Query  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKP 59
            +KVTF VE+GS+P  + + ++Y      + +V+L +  S+ W P+ +  G++W + S+  
Sbjct  168  LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHR 227
Query  60   LTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            LT PF++R  ++ G + V  +VIP  +     Y
Sbjct  228  LTAPFSLRITNESGKQLVASQVIPANWAPMAVY 260

Sequence Alignment: 41. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 51.5 bits 185,  Expect = 1e-08
 Identities = 32/92 34%, Positives = 52/92 56%, Gaps = 4/92 4%
Query  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVE-LRQHGSEEWEPLTKK-GNLWEVKSS- 57
            + V FKV+ GS+P  L + ++Y      LA V  ++  G   W+ + +  G  W + S+ 
Sbjct  172  MNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNT 231
Query  58   -KPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
             KPL+ PF+ R+ S  G   V + VIP+ ++ G TY
Sbjct  232  GKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTY 267

Sequence Alignment: 42. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 49.4 bits 176,  Expect = 6e-08
 Identities = 29/92 31%, Positives = 53/92 57%, Gaps = 5/92 5%
Query  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQ--HGSEE--WEPLTKK-GNLWEVK 55
            +KVTF V++GS+P  L + ++Y     T+  +EL Q  +G     W+ + +  G++W + 
Sbjct  168  MKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNGRPTGYWQDMRRSWGSVWRMD 227
Query  56   SSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            +++P+ GPF+ R  S  G   V +  IP  ++    Y
Sbjct  228  TNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAY 264

Sequence Alignment: 43. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 49.4 bits 176,  Expect = 6e-08
 Identities = 31/92 33%, Positives = 51/92 55%, Gaps = 3/92 3%
Query  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSE--EWEPLTKK-GNLWEVKSS 57
            +KV F VE+GS P  L + ++Y      +A+V+L++ G+    W P+ +  G++W + S+
Sbjct  169  LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSN 228
Query  58   KPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
              L  PF+ R  S  G   V  +VIP  +   T Y
Sbjct  229  HRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFY 263

Sequence Alignment: 44. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 45.2 bits 158,  Expect = 1e-06
 Identities = 24/90 26%, Positives = 51/90 56%, Gaps = 6/90 6%
Query  3    VTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQ-----HGSEEWEPLTKK-GNLWEVKS 56
            V F VE GS+P  L + +++     T+ ++++ +       +  W P+ +  G++W + +
Sbjct  159  VNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDA 218
Query  57   SKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            +  L GP ++R +S+ G   +  +VIP  ++  T Y
Sbjct  219  NHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254

Sequence Alignment: 45. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 44.0 bits 154,  Expect = 1e-06
 Identities = 28/90 31%, Positives = 46/90 51%, Gaps = 5/90 5%
Query  4    TFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGN--LWEVKSSKPLT 61
            T+ +E G D     L +        ++EV ++  G+ ++    K+     + + S +P+ 
Sbjct  28   TLTIEVGKDSTSTKLSLI---TNVAISEVSVKPKGATDFTDDLKESEPKTFTLDSKEPIE 84
Query  62   GPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE 96
            GP  FRF++KGG   V D  IP  FK G+ Y   E
Sbjct  85   GPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTE 119

Sequence Alignment: 46. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 44.1 bits 153,  Expect = 2e-06
 Identities = 27/92 29%, Positives = 50/92 54%, Gaps = 7/92 7%
Query  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEE------WEPLTKK-GNLWE 53
            +K+ F VE+GS+P  + + ++Y      + +V+L +  S        W P+ +  G++W 
Sbjct  170  LKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWR 229
Query  54   VKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            + S+  L  PF++R  S  G   V + VIP  +   + Y
Sbjct  230  LDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNY 268

Sequence Alignment: 47. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 44.1 bits 153,  Expect = 2e-06
 Identities = 26/90 28%, Positives = 48/90 53%, Gaps = 3/90 3%
Query  3    VTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQH-GSEEWEPLTKK-GNLWEVKSSKPL 60
            + F V+ GS+ + +   ++Y      LA+VEL++   S  W+ + +  G +W+     PL
Sbjct  177  IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQSWGAVWKFDKGSPL 236
Query  61   TGPFNFRFMS-KGGMRNVFDEVIPTAFKIGTTY 92
              PF+ ++ + + G   V + VIP  +  G TY
Sbjct  237  RAPFSIKLTTLESGQTIVANNVIPAGWTPGQTY 269

Sequence Alignment: 48. Allergen Name: Dac g 2 Sequence ID: Q41183

 Score = 40.7 bits 142,  Expect = 3e-06
 Identities = 22/33 66%, Positives = 26/33 78%, Gaps = 0/33 0%
Query  3    VTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELR 35
            VTF VEKGSD K L L IKY + GD++AEVEL+
Sbjct  4    VTFTVEKGSDEKNLALSIKYNKEGDSMAEVELK 36

Sequence Alignment: 49. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 43.2 bits 149,  Expect = 5e-06
 Identities = 26/92 28%, Positives = 53/92 57%, Gaps = 7/92 7%
Query  1    VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQ----HG--SEEWEPLTKK-GNLWE 53
            +K+ F VE+ S+P  + + ++Y      + +V+L +    HG  + +W P+ +  G++W 
Sbjct  181  LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWR 240
Query  54   VKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92
            + ++  L  PF+ R  ++ G   V + VIP  ++  T Y
Sbjct  241  LDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFY 279

Sequence Alignment: 50. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 40.9 bits 139,  Expect = 2e-05
 Identities = 29/91 31%, Positives = 56/91 61%, Gaps = 11/91 12%
Query  3    VTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQH--------GSEE--WEPLTKK-GNL 51
            VTF VE+GS+P  + + ++Y      + +V+L +         G+    W P+ +  G++
Sbjct  220  VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSI 279
Query  52   WEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYT 93
            W + ++ PL GPF++R  ++ G   + D+VIP  ++  T Y+
Sbjct  280  WRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYS 321

Sequence Alignment: 51. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 39.3 bits 134,  Expect = 3e-05
 Identities = 28/89 31%, Positives = 49/89 55%, Gaps = 7/89 7%
Query  3    VTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKG--NLWEVKSSKPL 60
            +T+ + K S   +LVL        D ++EV ++  G+ ++    K+     +  +S +P+
Sbjct  27   MTWTIGKDSTSTRLVL----VASAD-VSEVAVKDKGATDFSDDLKESPAKTFTYESKEPI 81
Query  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE 96
             GP++ RF  KG      D+VIP  FK G+ Y  +E
Sbjct  82   KGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKE 117

Sequence Alignment: 52. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 33.9 bits 109,  Expect = 0.003
 Identities = 23/83 27%, Positives = 40/83 48%, Gaps = 7/83 8%
Query  8    EKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPLTGPFNF 66
            EK   P++L +   Y      +  V++   GS  W+ +T+  G  W   +++   GP+ F
Sbjct  165  EKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQF 222
Query  67   RFMSKGGMRNVF----DEVIPTAFKIGTTY 92
            R +  GG    +     EV+P  +  G  Y
Sbjct  223  RVVVTGGYDGKWVWADGEVLPRRWTAGRVY 252

Sequence Alignment: 53. Allergen Name: Dac g 2 Sequence ID: AAB23303

 Score = 29.0 bits 92,  Expect = 0.008
 Identities = 15/22 68%, Positives = 16/22 72%, Gaps = 0/22 0%
Query  3    VTFKVEKGSDPKKLVLDIKYTR 24
            VTF VEKGSD K L L IKY +
Sbjct  4    VTFTVEKGSDEKNLALSIKYNK 25

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.