The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQPYPQPQPFLPQ
LPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQILQQQLIPCR
DVVLQQPNIAHASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQGFVQPQ
QLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN
Sequence Info Allergen Name Length Opt Bits Score E Value
CAY54134 Tri a 21.0101 281 2026 186.1 1.3e-48
AAA34279 Tri a gliadin 313 1528 143.7 8.1e-36
CAA26385 Tri a gliadin 313 1526 143.5 9.1e-36
AAA34278 Tri a gliadin 319 1484 139.9 1.1e-34
AAA34275 Tri a gliadin 318 1468 138.6 2.8e-34
AAA34276 Tri a gliadin 291 1239 119.0 1.9e-28
AAA34280 Tri a gliadin 286 1140 110.6 6.6e-26
CAA25261 Tri a gliadin 286 1131 109.8 1.1e-25
CAA26384 Tri a gliadin 286 1129 109.7 1.3e-25
CAA25593 Tri a gliadin 286 1120 108.9 2.2e-25
CAA35238 Tri a gliadin 307 1121 109.0 2.2e-25
AAA34282 Tri a gliadin 297 1104 107.6 5.7e-25
AAA34290 Tri a gliadin 296 1082 105.7 2.1e-24
CAA26383 Tri a gliadin 296 1081 105.6 2.2e-24
AAA34281 Tri a gliadin 262 955 94.8 3.4e-21
AAA17741 Tri a gliadin 287 909 90.9 5.5e-20
AAA34283 Tri a gliadin 282 804 82.0 2.7e-17
CAA44473 Tri a glutenin 285 740 76.5 1.2e-15
AAA34284 Tri a gliadin 186 731 75.7 1.4e-15
AAA34285 Tri a gliadin 304 708 73.8 8.3e-15
CAA36063 Tri a glutenin 295 703 73.4 1.1e-14
AAA34289 Tri a gliadin 327 632 67.4 7.8e-13
AAA34286 Tri a gliadin 323 628 67.0 9.8e-13
CAA30570 Tri a glutenin 356 588 63.6 1.1e-11
AAA34272 Tri a gliadin 302 585 63.4 1.2e-11
CAA31685 Tri a glutenin 307 584 63.3 1.3e-11
BAN29066 Tri a 20.0101 279 581 63.0 1.4e-11
AAA34288 Tri a gliadin 251 577 62.6 1.6e-11
BAA11251 Tri a gliadin 279 574 62.4 2.1e-11
AAA34274 Tri a gliadin 291 572 62.2 2.5e-11
CAA59338 Tri a glutenin 229 537 59.2 1.6e-10
CAA59340 Tri a glutenin 276 529 58.6 3e-10
AAA34287 Tri a gliadin 244 492 55.4 2.4e-09
CAA59339 Tri a glutenin 261 426 49.8 1.2e-07
P80198 Hor v 20.0101 289 409 48.4 3.7e-07
P80198 Hor v 21 289 409 48.4 3.7e-07
AEH31546 Tri a 36.0101 369 386 46.4 1.8e-06
CAA31395 Tri a glutenin 839 350 43.6 3e-05
CAA43331 Tri a glutenin 830 343 43.0 4.4e-05
P10388 Tri a 26.0101 839 338 42.5 6e-05
CAA27052 Tri a glutenin 838 332 42.0 8.6e-05
AAB02788 Tri a glutenin 815 323 41.3 0.00014
CAA26847 Tri a glutenin 660 310 40.1 0.00026
CAA43361 Tri a glutenin 705 310 40.1 0.00027
CAA31396 Tri a glutenin 648 285 38.0 0.0011
CAA28208 Tri a gliadin 154 246 34.3 0.0033
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 21.0101 Sequence ID: CAY54134

 Score = 186.1 bits 2026,  Expect = 1e-48
 Identities = 281/281 100%, Positives = 281/281 100%, Gaps = 0/281 0%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQPYPQPQPFLPQ 60
            VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQPYPQPQPFLPQ
Sbjct  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQPYPQPQPFLPQ 60
Query  61   LPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQILQQQLIPCR 120
            LPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQILQQQLIPCR
Sbjct  61   LPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQILQQQLIPCR 120
Query  121  DVVLQQPNIAHASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQQ 180
            DVVLQQPNIAHASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQQ
Sbjct  121  DVVLQQPNIAHASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQQ 180
Query  181  QQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQGFVQPQ 240
            QQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQGFVQPQ
Sbjct  181  QQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQGFVQPQ 240
Query  241  QLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            QLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN
Sbjct  241  QLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281

Sequence Alignment: 2. Allergen Name: Tri a gliadin Sequence ID: AAA34279

 Score = 143.7 bits 1528,  Expect = 8e-36
 Identities = 253/279 90%, Positives = 261/279 93%, Gaps = 19/279 6%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPY---- 51
            VRVPVPQLQP+NPSQQQPQEQVPLVQQQQF GQQQQ FP QQ     QPFP QQPY    
Sbjct  18   VRVPVPQLQPKNPSQQQPQEQVPLVQQQQFPGQQQQ-FPPQQPYPQPQPFPSQQPYLQLQ 76
Query  52   --PQPQPFLPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ--- 106
              PQPQPFLPQLPYPQPQ FPPQQ YPQ +P+Y QPQQPISQQQAQ QQQQQQQQQQ   
Sbjct  77   PFPQPQPFLPQLPYPQPQSFPPQQPYPQQRPKYLQPQQPISQQQAQQQQQQQQQQQQQQQ 136
Query  107  --ILQQILQQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQA 163
              ILQQILQQQLIPCRDVVLQQ NIAHASSQV QQS YQLLQQLCCQQL Q PEQSRCQA
Sbjct  137  QQILQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSRCQA 196
Query  164  IHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGS 223
            IHNV+HAII+H QQ+QQQQ QQQQQQQ QQQQQQQQQQQQPSSQVS+QQPQQQYPS QGS
Sbjct  197  IHNVVHAIIMH-QQEQQQQLQQQQQQQLQQQQQQQQQQQQPSSQVSFQQPQQQYPSSQGS 255
Query  224  FQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            FQPSQQNPQAQG VQPQQLPQF EIRNLALQTLPAMCNVYIPP+CSTTIAPFGIF TN
Sbjct  256  FQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGIFGTN 313

Sequence Alignment: 3. Allergen Name: Tri a gliadin Sequence ID: CAA26385

 Score = 143.5 bits 1526,  Expect = 9e-36
 Identities = 253/279 90%, Positives = 260/279 93%, Gaps = 19/279 6%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPY---- 51
            VRVPVPQLQP+NPSQQQPQEQVPLVQQQQF GQQQQ FP QQ     QPFP QQPY    
Sbjct  18   VRVPVPQLQPKNPSQQQPQEQVPLVQQQQFPGQQQQ-FPPQQPYPQPQPFPSQQPYLQLQ 76
Query  52   --PQPQPFLPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ--- 106
              PQPQPFLPQLPYPQPQ FPPQQ YPQ +P Y QPQQPISQQQAQ QQQQQQQQQQ   
Sbjct  77   PFPQPQPFLPQLPYPQPQSFPPQQPYPQQRPMYLQPQQPISQQQAQQQQQQQQQQQQQQQ 136
Query  107  --ILQQILQQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQA 163
              ILQQILQQQLIPCRDVVLQQ NIAHASSQV QQS YQLLQQLCCQQL Q PEQSRCQA
Sbjct  137  QQILQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSRCQA 196
Query  164  IHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGS 223
            IHNV+HAII+H QQ+QQQQ QQQQQQQ QQQQQQQQQQQQPSSQVS+QQPQQQYPS QGS
Sbjct  197  IHNVVHAIIMH-QQEQQQQLQQQQQQQLQQQQQQQQQQQQPSSQVSFQQPQQQYPSSQGS 255
Query  224  FQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            FQPSQQNPQAQG VQPQQLPQF EIRNLALQTLPAMCNVYIPP+CSTTIAPFGIF TN
Sbjct  256  FQPSQQNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGIFGTN 313

Sequence Alignment: 4. Allergen Name: Tri a gliadin Sequence ID: AAA34278

 Score = 139.9 bits 1484,  Expect = 1e-34
 Identities = 252/280 90%, Positives = 258/280 92%, Gaps = 20/280 7%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPY---- 51
            VRVPVPQLQPQNPSQQQPQEQVPLVQQQQF GQQQQ FP QQ     QPFP QQPY    
Sbjct  21   VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQQ-FPPQQPYPQPQPFPSQQPYLQLQ 79
Query  52   --PQPQPFLPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ--- 106
              PQPQPF PQLPYPQPQ FPPQQ YPQ QPQY QPQQPISQQQAQ QQQQQQQQQQ   
Sbjct  80   PFPQPQPFPPQLPYPQPQSFPPQQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQQQQQQ 139
Query  107  ILQQILQQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIH 165
            ILQQILQQQLIPCRDVVLQQ NIAHASSQV QQS YQLLQQLCCQQL Q PEQS+CQAIH
Sbjct  140  ILQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSQCQAIH 199
Query  166  NVIHAIILHHQQQQQQQQ----QQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQ 221
            NV HAII+H+QQQQQQ+Q    QQQQQQQQQ QQQQQQQQQQPSSQVS+QQPQQQYPS Q
Sbjct  200  NVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSFQQPQQQYPSSQ 259
Query  222  GSFQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
             SFQPSQ NPQAQG VQPQQLPQF EIRNLALQTLPAMCNVYIPP+CSTTIAPFGI  TN
Sbjct  260  VSFQPSQLNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGISGTN 319

Sequence Alignment: 5. Allergen Name: Tri a gliadin Sequence ID: AAA34275

 Score = 138.6 bits 1468,  Expect = 3e-34
 Identities = 251/279 89%, Positives = 257/279 92%, Gaps = 21/279 7%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPY---- 51
            VRVPVPQLQPQNPSQQQPQEQVPLVQQQQF GQQQQ FP QQ     QPFP QQPY    
Sbjct  21   VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQQ-FPPQQPYPQPQPFPSQQPYLQLQ 79
Query  52   --PQPQPFLPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ--- 106
              PQPQPF P LPYPQPQ FPPQQ YPQ QPQY QPQQPISQQQAQ QQQQQQQQQQ   
Sbjct  80   PFPQPQPF-PPLPYPQPQSFPPQQPYPQQQPQYLQPQQPISQQQAQQQQQQQQQQQQQQQ 138
Query  107  ILQQILQQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIH 165
            ILQQILQQQLIPCRDVVLQQ NIAHASSQV QQS YQLLQQLCCQQL Q PEQS+CQAIH
Sbjct  139  ILQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSTYQLLQQLCCQQLLQIPEQSQCQAIH 198
Query  166  NVIHAIILHHQQQQQQQQ----QQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQ 221
            NV HAII+H+QQQQQQ+Q    QQQQQQQQQ QQQQQQQQQQPSSQVS+QQPQQQYPS Q
Sbjct  199  NVAHAIIMHQQQQQQQEQKQQLQQQQQQQQQLQQQQQQQQQQPSSQVSFQQPQQQYPSSQ 258
Query  222  GSFQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
             SFQPSQ NPQAQG VQPQQLPQF EIRNLALQTLPAMCNVYIPP+CSTTIAPFGI  TN
Sbjct  259  VSFQPSQLNPQAQGSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGISGTN 318

Sequence Alignment: 6. Allergen Name: Tri a gliadin Sequence ID: AAA34276

 Score = 119.0 bits 1239,  Expect = 2e-28
 Identities = 234/264 88%, Positives = 243/264 92%, Gaps = 24/264 9%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPYPQPQ 55
            VRVPVPQLQ QNPSQQQPQEQVPLVQ+QQF GQQQ  FP QQ     QPFP QQPY Q Q
Sbjct  21   VRVPVPQLQLQNPSQQQPQEQVPLVQEQQFQGQQQP-FPPQQPYPQPQPFPSQQPYLQLQ 79
Query  56   PF-LPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQILQQ 114
            PF  PQLPYPQPQPF PQQ YPQPQPQY QPQQPISQQQ Q QQQQQQQQQQILQQILQQ
Sbjct  80   PFPQPQLPYPQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQ-QQQQQQQQQQILQQILQQ 138
Query  115  QLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIIL 173
            QLIPCRDVVLQQ NIAH SSQV Q+S YQL+QQLCCQQLWQ PEQSRCQAIHNV+HAIIL
Sbjct  139  QLIPCRDVVLQQHNIAHGSSQVLQESTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIIL 198
Query  174  HHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQA 233
            H             QQ++++QQQQQQQQQQP SQVS+QQPQQQYPSGQG FQPSQQNPQA
Sbjct  199  H-------------QQHHHHQQQQQQQQQQPLSQVSFQQPQQQYPSGQGFFQPSQQNPQA 245
Query  234  QGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            QG  QPQQLPQFEEIRNLALQTLPAMCNVYIPPYC  TIAPFGIF TN
Sbjct  246  QGSFQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN 291

Sequence Alignment: 7. Allergen Name: Tri a gliadin Sequence ID: AAA34280

 Score = 110.6 bits 1140,  Expect = 7e-26
 Identities = 226/257 87%, Positives = 233/257 90%, Gaps = 33/257 12%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPYPQPQ 55
            VR PVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQ  FP QQ     QPFP Q PY Q Q
Sbjct  21   VRFPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQP-FPPQQPYPQPQPFPSQLPYLQLQ 79
Query  56   PF-LPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ--ILQQIL 112
            PF  PQLPY QPQPF PQQ YPQPQPQY QPQQPISQQQ Q QQQQQQQQQQ  ILQQIL
Sbjct  80   PFPQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQILQQIL 139
Query  113  QQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHNVIHAI 171
            QQQLIPC DVVLQQ NIAH  SQV QQS YQLLQ+LCCQ+LWQ PEQS+CQAIHNV+HAI
Sbjct  140  QQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI 199
Query  172  ILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNP 231
            ILH                     QQQ+QQQQPSSQVS+QQP QQYP GQGSF+PSQQNP
Sbjct  200  ILH---------------------QQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNP 238
Query  232  QAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            QAQG VQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC  TIAPFGIF TN
Sbjct  239  QAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN 286

Sequence Alignment: 8. Allergen Name: Tri a gliadin Sequence ID: CAA25261

 Score = 109.8 bits 1131,  Expect = 1e-25
 Identities = 225/257 87%, Positives = 232/257 90%, Gaps = 33/257 12%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPYPQPQ 55
            VR PVPQLQPQNPSQQ PQEQVPLVQQQQFLGQQQ  FP QQ     QPFP Q PY Q Q
Sbjct  21   VRFPVPQLQPQNPSQQLPQEQVPLVQQQQFLGQQQP-FPPQQPYPQPQPFPSQLPYLQLQ 79
Query  56   PF-LPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ--ILQQIL 112
            PF  PQLPY QPQPF PQQ YPQPQPQY QPQQPISQQQ Q QQQQQQQQQQ  ILQQIL
Sbjct  80   PFPQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQILQQIL 139
Query  113  QQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHNVIHAI 171
            QQQLIPC DVVLQQ NIAH  SQV QQS YQLLQ+LCCQ+LWQ PEQS+CQAIHNV+HAI
Sbjct  140  QQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI 199
Query  172  ILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNP 231
            ILH                     QQQ+QQQQPSSQVS+QQP QQYP GQGSF+PSQQNP
Sbjct  200  ILH---------------------QQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNP 238
Query  232  QAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            QAQG VQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC  TIAPFGIF TN
Sbjct  239  QAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN 286

Sequence Alignment: 9. Allergen Name: Tri a gliadin Sequence ID: CAA26384

 Score = 109.7 bits 1129,  Expect = 1e-25
 Identities = 225/257 87%, Positives = 232/257 90%, Gaps = 33/257 12%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPYPQPQ 55
            VR PVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQ  FP QQ     QPFP Q PY Q Q
Sbjct  21   VRFPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQP-FPPQQPYPQPQPFPSQLPYLQLQ 79
Query  56   PF-LPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ--ILQQIL 112
            PF  PQLPY QPQ F PQQ YPQPQPQY QPQQPISQQQ Q QQQQQQQQQQ  ILQQIL
Sbjct  80   PFPQPQLPYSQPQQFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQILQQIL 139
Query  113  QQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHNVIHAI 171
            QQQLIPC DVVLQQ NIAH  SQV QQS YQLLQ+LCCQ+LWQ PEQS+CQAIHNV+HAI
Sbjct  140  QQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI 199
Query  172  ILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNP 231
            ILH                     QQQ+QQQQPSSQVS+QQP QQYP GQGSF+PSQQNP
Sbjct  200  ILH---------------------QQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNP 238
Query  232  QAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            QAQG VQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC  TIAPFGIF TN
Sbjct  239  QAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN 286

Sequence Alignment: 10. Allergen Name: Tri a gliadin Sequence ID: CAA25593

 Score = 108.9 bits 1120,  Expect = 2e-25
 Identities = 224/257 87%, Positives = 231/257 89%, Gaps = 33/257 12%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPYPQPQ 55
            VR PVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQ  FP QQ     QPFP Q PY Q Q
Sbjct  21   VRFPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQP-FPPQQPYPQPQPFPSQLPYLQLQ 79
Query  56   PF-LPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ--ILQQIL 112
            PF  PQLPY QPQPF PQQ YPQPQPQY QPQQPISQQQ Q QQQQQQQQQQ  ILQQIL
Sbjct  80   PFPQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQILQQIL 139
Query  113  QQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHNVIHAI 171
            QQQLIPC DVVLQQ NIAH  SQV QQS YQLLQ+LCCQ+LWQ PEQS+CQAI  V+HAI
Sbjct  140  QQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAILKVVHAI 199
Query  172  ILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNP 231
            ILH                     QQQ+QQQQPSSQVS+QQP QQYP GQGSF+PSQQNP
Sbjct  200  ILH---------------------QQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNP 238
Query  232  QAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            QAQG VQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC  TIAPFGIF TN
Sbjct  239  QAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN 286

Sequence Alignment: 11. Allergen Name: Tri a gliadin Sequence ID: CAA35238

 Score = 109.0 bits 1121,  Expect = 2e-25
 Identities = 236/262 90%, Positives = 243/262 92%, Gaps = 44/262 16%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQ-----------QHFPGQQ-----QP 44
            VRVPVPQLQPQNPSQQQPQEQVPLVQQQQF GQQQ           Q FP QQ     QP
Sbjct  21   VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQPFPPQQPYPQPQPFPSQQPYLQLQP 80
Query  45   FP-PQQPYPQPQ-PF-LPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQ 101
            FP PQ PYPQPQ P+  PQLPYPQPQPF PQQ YPQ QPQY QPQQPISQQQ Q QQQQQ
Sbjct  81   FPQPQLPYPQPQLPYPQPQLPYPQPQPFRPQQPYPQSQPQYSQPQQPISQQQQQQQQQQQ 140
Query  102  Q-----QQQQILQQILQQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQT 155
            Q     QQQQILQQILQQQLIPCRDVVLQQ +IA+ SSQV QQS YQL+QQLCCQQLWQ 
Sbjct  141  QKQQQQQQQQILQQILQQQLIPCRDVVLQQHSIAYGSSQVLQQSTYQLVQQLCCQQLWQI 200
Query  156  PEQSRCQAIHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQ 215
            PEQSRCQAIHNV+HAIILH                 QQQQQQQQQQQQP SQVS+QQPQQ
Sbjct  201  PEQSRCQAIHNVVHAIILH-----------------QQQQQQQQQQQQPLSQVSFQQPQQ 243
Query  216  QYPSGQGSFQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPF 275
            QYPSGQGSFQPSQQNPQAQG VQPQQLPQFEEIRNLAL+TLPAMCNVYIPPYC  TIAP 
Sbjct  244  QYPSGQGSFQPSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYC--TIAPV 301
Query  276  GIFSTN 281
            GIF TN
Sbjct  302  GIFGTN 307

Sequence Alignment: 12. Allergen Name: Tri a gliadin Sequence ID: AAA34282

 Score = 107.6 bits 1104,  Expect = 6e-25
 Identities = 237/263 90%, Positives = 246/263 93%, Gaps = 32/263 12%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQ-----QHFPGQQQPFPPQQPY---- 51
            VRVPVPQLQPQNPSQQQPQ+QVPLVQQQQF GQQQ     Q +P QQQPFP QQPY    
Sbjct  21   VRVPVPQLQPQNPSQQQPQKQVPLVQQQQFPGQQQPFPPQQPYP-QQQPFPSQQPYMQLQ 79
Query  52   --PQPQ-PF-LPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQI 107
              PQPQ P+  PQLPYPQPQPF PQQSYPQPQPQY QPQQPISQQQ Q QQQQQQQQQQI
Sbjct  80   PFPQPQLPYPQPQLPYPQPQPFRPQQSYPQPQPQYSQPQQPISQQQQQ-QQQQQQQQQQI 138
Query  108  LQQILQQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHN 166
            LQQILQQQLIPCRDVVLQQ +IAH SSQV QQS YQL+QQ+CCQQLWQ PEQSRCQAIHN
Sbjct  139  LQQILQQQLIPCRDVVLQQHSIAHGSSQVLQQSTYQLVQQFCCQQLWQIPEQSRCQAIHN 198
Query  167  VIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQP 226
            V+HAIILH              QQQQQQQQQQQQQQQP SQV +QQ QQQYPSGQGSFQP
Sbjct  199  VVHAIILH--------------QQQQQQQQQQQQQQQPLSQVCFQQSQQQYPSGQGSFQP 244
Query  227  SQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            SQQNPQAQG VQPQQLPQFEEIRNLAL+TLPAMCNVYIPPYC  TIAP GIF TN
Sbjct  245  SQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYC--TIAPVGIFGTN 297

Sequence Alignment: 13. Allergen Name: Tri a gliadin Sequence ID: AAA34290

 Score = 105.7 bits 1082,  Expect = 2e-24
 Identities = 234/258 90%, Positives = 235/258 91%, Gaps = 41/258 15%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPY---- 51
            VRVPVPQ QPQNPSQ QPQ QVPLVQQQQF GQQQQ FP QQ     QPFP QQPY    
Sbjct  21   VRVPVPQPQPQNPSQPQPQRQVPLVQQQQFPGQQQQ-FPPQQPYPQPQPFPSQQPYLQLQ 79
Query  52   --PQPQPFLPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ--- 106
              PQPQPF PQLPYPQP PF PQQ YPQPQPQYPQPQQPISQQQAQ QQQQQQQQQQ   
Sbjct  80   PFPQPQPFPPQLPYPQPPPFSPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQ 139
Query  107  ---ILQQILQQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQ 162
               IL QILQQQLIPCRDVVLQQ NIAHA SQV QQS YQ LQQLCCQQLWQ PEQSRCQ
Sbjct  140  QQQILPQILQQQLIPCRDVVLQQHNIAHARSQVLQQSTYQPLQQLCCQQLWQIPEQSRCQ 199
Query  163  AIHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQG 222
            AIHNV+HAIILH                      QQQQQQQPSSQVS QQPQQQYPSGQG
Sbjct  200  AIHNVVHAIILH----------------------QQQQQQQPSSQVSLQQPQQQYPSGQG 237
Query  223  SFQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
             FQPSQQNPQAQG VQPQQLPQFEEIRNLALQTLP MCNVYIPPYCSTT APFGIF TN
Sbjct  238  FFQPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTTAPFGIFGTN 296

Sequence Alignment: 14. Allergen Name: Tri a gliadin Sequence ID: CAA26383

 Score = 105.6 bits 1081,  Expect = 2e-24
 Identities = 235/258 91%, Positives = 237/258 91%, Gaps = 41/258 15%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPY---- 51
            VRVPVPQ QPQNPSQ QPQ QVPLVQQQQF GQQQQ FP QQ     QPFP QQPY    
Sbjct  21   VRVPVPQPQPQNPSQPQPQGQVPLVQQQQFPGQQQQ-FPPQQPYPQPQPFPSQQPYLQLQ 79
Query  52   --PQPQPFLPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ--- 106
              PQPQPF PQLPYPQP PF PQQ YPQPQPQYPQPQQPISQQQAQ QQQQQQQQQQ   
Sbjct  80   PFPQPQPFPPQLPYPQPPPFSPQQPYPQPQPQYPQPQQPISQQQAQQQQQQQQQQQQQQQ 139
Query  107  ---ILQQILQQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQ 162
               ILQQILQQQLIPCRDVVLQQ NIAHA SQV QQS YQ LQQLCCQQLWQ PEQSRCQ
Sbjct  140  QQQILQQILQQQLIPCRDVVLQQHNIAHARSQVLQQSTYQPLQQLCCQQLWQIPEQSRCQ 199
Query  163  AIHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQG 222
            AIHNV+HAIILH                      QQQ+QQQPSSQVS QQPQQQYPSGQG
Sbjct  200  AIHNVVHAIILH----------------------QQQRQQQPSSQVSLQQPQQQYPSGQG 237
Query  223  SFQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
             FQPSQQNPQAQG VQPQQLPQFEEIRNLALQTLP MCNVYIPPYCSTTIAPFGIF TN
Sbjct  238  FFQPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPRMCNVYIPPYCSTTIAPFGIFGTN 296

Sequence Alignment: 15. Allergen Name: Tri a gliadin Sequence ID: AAA34281

 Score = 94.8 bits 955,  Expect = 3e-21
 Identities = 201/230 87%, Positives = 209/230 90%, Gaps = 32/230 13%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPYPQPQ 55
            VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQ  FP QQ     QPFP QQPY Q Q
Sbjct  21   VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQP-FPPQQPYPQPQPFPSQQPYLQLQ 79
Query  56   PFL-PQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ---ILQQI 111
            PFL PQLPY QPQPF PQQ YPQPQPQY QPQQPISQQQ Q QQQQQQQQQQ   I+QQI
Sbjct  80   PFLQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQI 139
Query  112  LQQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHNVIHA 170
            LQQQLIPC DVVLQQ NI H  SQV QQS YQLLQ+LCCQ+LWQ PEQS+CQAIHNV+HA
Sbjct  140  LQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHA 199
Query  171  IILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQN 230
            IILH                     QQQ+QQQQPSSQVS+QQP QQYP GQGSF+PSQQN
Sbjct  200  IILH---------------------QQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQN 238
Query  231  PQAQGFVQPQQLPQFEEIRNLA 252
            PQAQG VQPQQLPQFEEIRNLA
Sbjct  239  PQAQGSVQPQQLPQFEEIRNLA 260

Sequence Alignment: 16. Allergen Name: Tri a gliadin Sequence ID: AAA17741

 Score = 90.9 bits 909,  Expect = 6e-20
 Identities = 227/257 88%, Positives = 235/257 91%, Gaps = 34/257 13%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQ-----QPFPPQQPYPQPQ 55
            VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQ  FP QQ     QPFP QQPY Q Q
Sbjct  21   VRVPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQP-FPPQQPYPQPQPFPSQQPYLQLQ 79
Query  56   PFL-PQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQ---ILQQI 111
            PFL PQLPY QPQPF PQQ YPQPQPQY QPQQPISQQQ Q QQQQQQQQQQ   I+QQI
Sbjct  80   PFLQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQI 139
Query  112  LQQQLIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHNVIHA 170
            LQQQLIPC DVVLQQ NI H  SQV QQS YQLLQ+LCCQ+LWQ PEQS+CQAIHNV+HA
Sbjct  140  LQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHA 199
Query  171  IILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQN 230
            IILH                     QQQ+QQQQPSSQVS+QQP QQYP GQGSF+PSQQN
Sbjct  200  IILH---------------------QQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQN 238
Query  231  PQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            PQAQG VQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC  TIAPFGIF TN
Sbjct  239  PQAQGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYC--TIAPFGIFGTN 287

Sequence Alignment: 17. Allergen Name: Tri a gliadin Sequence ID: AAA34283

 Score = 82.0 bits 804,  Expect = 3e-17
 Identities = 232/256 90%, Positives = 239/256 93%, Gaps = 31/256 12%
Query  1    VRVPVPQLQPQNPSQQQPQEQVPLVQQQQ-FLGQQQQHFPGQ----QQPFPPQQPYPQPQ 55
            VRVPVPQLQPQNPSQQQPQEQVPL+QQQQ F GQQ+Q  P Q    QQPFP QQPYPQPQ
Sbjct  21   VRVPVPQLQPQNPSQQQPQEQVPLMQQQQQFPGQQEQFPPQQPYPHQQPFPSQQPYPQPQ 80
Query  56   PFLPQLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQILQQQ 115
            PF PQLPYPQ QPFPPQQ YPQPQPQYPQPQQPISQQQAQ    QQQQQQQ LQQILQQQ
Sbjct  81   PFPPQLPYPQTQPFPPQQPYPQPQPQYPQPQQPISQQQAQ----QQQQQQQTLQQILQQQ 136
Query  116  LIPCRDVVLQQPNIAHASSQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILH 174
            LIPCRDVVLQQ NIAHASSQV QQS YQ LQQLCCQQL+Q PEQSRCQAIHNV+HAIILH
Sbjct  137  LIPCRDVVLQQHNIAHASSQVLQQSSYQQLQQLCCQQLFQIPEQSRCQAIHNVVHAIILH 196
Query  175  HQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQ 234
            H+QQQQQQ                     PSSQVSYQQPQ+QYPSGQ SFQ SQQNPQAQ
Sbjct  197  HHQQQQQQ---------------------PSSQVSYQQPQEQYPSGQVSFQSSQQNPQAQ 235
Query  235  GFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            G VQPQQLPQF+EIRNLALQTLPAMCNVYIPPYCSTTIAPFGIF TN
Sbjct  236  GSVQPQQLPQFQEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFGTN 282

Sequence Alignment: 18. Allergen Name: Tri a glutenin Sequence ID: CAA44473

 Score = 76.5 bits 740,  Expect = 1e-15
 Identities = 139/245 56%, Positives = 170/245 69%, Gaps = 34/245 13%
Query  13   PSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQ--PFPPQQPYPQPQPFLPQLPYPQPQPFP 70
            P  ++P +Q PL  QQ F   QQ  F  QQQ  PFP Q  + Q QP LPQ P     PFP
Sbjct  27   PGLERPWQQQPLPPQQTF--PQQPPFSQQQQQQPFPQQPSFSQQQPILPQGP-----PFP 79
Query  71   PQQSYPQPQPQYPQPQQPISQQQAQL---QQQQQQQQQQI--LQQILQQQLIPCRDVVLQ 125
             QQ+    QP  PQ Q P SQQQ  +   QQQQQ  QQQI  +Q  + QQL PC+ V LQ
Sbjct  80   -QQT----QPVLPQ-QSPFSQQQQLILPPQQQQQLPQQQISIVQPSVLQQLNPCK-VFLQ 132
Query  126  Q---P-NIAH--ASSQVSQQSY-QLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQ 178
            Q   P  I +  A SQ+ QQS  +++QQ CCQQL Q PEQSR  AI  + ++IIL+ QQQ
Sbjct  133  QQCSPVAIPQRLARSQMWQQSSCHVMQQQCCQQLSQIPEQSRYDAIRAITYSIILQEQQQ 192
Query  179  QQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQGFVQ 238
             Q QQQQ QQ  Q   Q QQQ QQQ   Q S+QQPQQQ   GQ   QP QQ  Q   F+Q
Sbjct  193  GQSQQQQPQQSGQGVSQSQQQSQQQ-LGQCSFQQPQQQL--GQ---QPQQQQVQQGTFLQ 246
Query  239  PQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGI 277
            P+Q+ ++E + ++AL+TLP MC+V +P Y STT  PFG+
Sbjct  247  PHQIAHLEVMTSIALRTLPTMCSVNVPLYSSTTSVPFGV 285

Sequence Alignment: 19. Allergen Name: Tri a gliadin Sequence ID: AAA34284

 Score = 75.7 bits 731,  Expect = 1e-15
 Identities = 162/183 88%, Positives = 169/183 92%, Gaps = 26/183 14%
Query  76   PQPQPQYPQPQQPISQQQAQLQQQQQQQQQ--QILQQILQQQLIPCRDVVLQQPNIAHAS 133
            PQPQPQY QPQQPISQQQ Q QQQQQQQQQ  QILQQILQQQLIPC DVVLQQ NIAH  
Sbjct  1    PQPQPQYSQPQQPISQQQQQQQQQQQQQQQEQQILQQILQQQLIPCMDVVLQQHNIAHGR 60
Query  134  SQVSQQS-YQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQQQQQQQQQQQQQQ 192
            SQV QQS YQLLQ+LCCQ+LWQ PEQS+CQAIHNV+HAIILH                  
Sbjct  61   SQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILH------------------ 102
Query  193  QQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQGFVQPQQLPQFEEIRNLA 252
              QQQQ+QQQQPSSQ S+QQP QQYP GQGSF+PSQQNPQAQG VQPQQLPQFE IRNLA
Sbjct  103  --QQQQKQQQQPSSQFSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQLPQFE-IRNLA 159
Query  253  LQTLPAMCNVYIPPYCSTTIAPFGIFSTN 281
            LQTLPAMCNVYIPPYC  TIAPFGIF TN
Sbjct  160  LQTLPAMCNVYIPPYC--TIAPFGIFGTN 186

Sequence Alignment: 20. Allergen Name: Tri a gliadin Sequence ID: AAA34285

 Score = 73.8 bits 708,  Expect = 8e-15
 Identities = 138/249 55%, Positives = 170/249 68%, Gaps = 37/249 14%
Query  11   QNPSQQQP-QEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQP-YPQPQPFLPQLPYPQPQP 68
            + P QQQP   Q  + QQ  F  QQQQ +P QQ  F  QQP + Q QP L Q P     P
Sbjct  30   ERPWQQQPLPPQQSFSQQPPFSQQQQQPLP-QQPSFSQQQPPFSQQQPILSQQP-----P 83
Query  69   FPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQI------LQQQLIPCRDV 122
            F  QQ     QP  PQ Q P SQQQ  +   QQQQQQ + QQI      + QQL PC+ V
Sbjct  84   FSQQQ-----QPVLPQ-QSPFSQQQQLVLPPQQQQQQLVQQQIPIVQPSVLQQLNPCK-V 136
Query  123  VLQQPN--IAH----ASSQVSQQSY-QLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHH 175
             LQQ    +A     A SQ+ QQS  +++QQ CCQQL Q PEQSR +AI  +I++IIL+ 
Sbjct  137  FLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQSRYEAIRAIIYSIILQE 196
Query  176  QQQQ-QQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQA- 233
            QQQ   Q QQQQ QQ  Q   Q QQQ QQ   Q S+QQPQQQ   GQ   QP QQ  Q  
Sbjct  197  QQQGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQL--GQ---QPQQQQQQQV 251
Query  234  -QG-FVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGI 277
             QG F+QP+Q+ ++E + ++AL+TLP MC+V +P Y +TT  PFG+
Sbjct  252  LQGTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFGV 297

Sequence Alignment: 21. Allergen Name: Tri a glutenin Sequence ID: CAA36063

 Score = 73.4 bits 703,  Expect = 1e-14
 Identities = 132/247 53%, Positives = 165/247 66%, Gaps = 32/247 12%
Query  13   PSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQP-FPPQQP-YPQPQPFLPQLPYPQPQPFP 70
            P  ++P ++ PL   Q+ L  QQQ FP QQQP F  QQP + Q QP LPQLP+ Q Q   
Sbjct  27   PGLERPWQEQPL-PPQHTLFPQQQPFPQQQQPPFSQQQPSFLQQQPILPQLPFSQQQ--- 82
Query  71   PQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQ--QQ---ILQQILQQQLIPCRDVVLQ 125
                    QP  PQ Q P SQQQ  L  QQQ QQ  QQ   I+Q  + QQL PC+  + Q
Sbjct  83   --------QPVLPQ-QSPFSQQQLVLPPQQQYQQVLQQQIPIVQPSVLQQLNPCKVFLQQ 133
Query  126  QPN-IAH----ASSQVSQQSY-QLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQ 179
            Q N +A     A SQ+ QQS  +++QQ CCQQL Q PEQSR   I  + ++IIL+ QQQ 
Sbjct  134  QCNPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPEQSRYDVIRAITYSIILQEQQQG 193
Query  180  -QQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQGFVQ 238
              Q QQQQ QQ  Q   Q QQQ QQ   Q S+QQPQQQ   GQ   QP QQ      F+Q
Sbjct  194  FVQAQQQQPQQLGQGVSQSQQQSQQQLGQCSFQQPQQQL--GQ---QPQQQQVLQGTFLQ 248
Query  239  PQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGI 277
            P+Q+ ++E + ++AL+TLP MC+V +P Y STT  PF +
Sbjct  249  PHQIAHLEVMTSIALRTLPTMCSVNVPLYSSTTSVPFSV 287

Sequence Alignment: 22. Allergen Name: Tri a gliadin Sequence ID: AAA34289

 Score = 67.4 bits 632,  Expect = 8e-13
 Identities = 143/239 59%, Positives = 172/239 71%, Gaps = 53/239 22%
Query  9    QPQNPSQQQPQEQVPLVQQ-QQFLGQQQQHFPGQ-QQPFP----PQQPYPQ-PQ-PF--- 57
            QPQ    +QPQ+QVP  QQ QQ + Q QQ FP Q QQPFP    PQQP+PQ PQ PF   
Sbjct  54   QPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQT 113
Query  58   -LPQLPYPQ-PQ-PFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQ------QQQQQIL 108
              PQ P+PQ PQ PFP  Q   QP PQ  QPQQP  Q Q QL Q QQ      QQQ+  +
Sbjct  114  QQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFI 173
Query  109  QQILQQQLIPCRDVVLQQPNIAHASSQV-----SQQSYQLLQQLCCQQLWQTPEQSRCQA 163
            Q  LQQQL PC++++LQQ   A   S +      Q   Q+++Q CCQQL Q P+Q +C A
Sbjct  174  QPSLQQQLNPCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAA 233
Query  164  IHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGS 223
            IH+V+H+II+              QQQQQQQQQQ      P SQ      ++Q   GQGS
Sbjct  234  IHSVVHSIIM--------------QQQQQQQQQQGIDIFLPLSQ------HEQV--GQGS 271
Query  224  FQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPF 275
            +       Q QG +QPQQ  Q+E IR+L LQTLP+MCNVY+PP CS   APF
Sbjct  272  LV------QGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPF 317

Sequence Alignment: 23. Allergen Name: Tri a gliadin Sequence ID: AAA34286

 Score = 67.0 bits 628,  Expect = 1e-12
 Identities = 125/254 49%, Positives = 161/254 63%, Gaps = 35/254 13%
Query  6    PQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQPYPQPQPFLPQLPYPQ 65
            P     +P+   P  +        F  Q + H P  ++ +P      Q QP     P+ Q
Sbjct  46   PLNNNNSPNNNSPSNHHNNSPNNNF--QYHTH-PSNHKNLPHTNNIQQQQP-----PFSQ 97
Query  66   PQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQI------LQQQLIPC 119
             Q  P  Q   Q QP  PQ Q P SQQQ  +   QQQQQQ + QQI      + QQL PC
Sbjct  98   QQQPPFSQ---QQQPVLPQ-QSPFSQQQQLVLPPQQQQQQLVQQQIPIVQPSVLQQLNPC 153
Query  120  RDVVLQQPN--IAH----ASSQVSQQSY-QLLQQLCCQQLWQTPEQSRCQAIHNVIHAII 172
            + V LQQ    +A     A SQ+ QQS  +++QQ CCQQL Q PEQSR +AI  +I++II
Sbjct  154  K-VFLQQQCSPVAMPQRLARSQMWQQSSCHVMQQQCCQQLQQIPEQSRYEAIRAIIYSII 212
Query  173  LHHQQQQ-QQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNP 231
            L+ QQQ   Q QQQQ QQ  Q   Q QQQ QQ   Q S+QQPQQQ   GQ   QP QQ  
Sbjct  213  LQEQQQGFVQPQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQL--GQ---QPQQQQQ 267
Query  232  QA--QG-FVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGI 277
            Q   QG F+QP+Q+ ++E + ++AL+TLP MC+V +P Y +TT  PFG+
Sbjct  268  QQVLQGTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFGV 316

Sequence Alignment: 24. Allergen Name: Tri a glutenin Sequence ID: CAA30570

 Score = 63.6 bits 588,  Expect = 1e-11
 Identities = 145/261 55%, Positives = 177/261 67%, Gaps = 49/261 18%
Query  4    PVPQLQPQNP--SQQQP--QEQVPLVQQQQ--FLGQQQQHFPGQQQPFPPQQ---PYPQP 54
            P  Q Q Q P   QQQP   +Q P+ QQQQ  F  QQQ +F  QQQP   QQ   PY Q 
Sbjct  53   PFSQQQQQPPFAQQQQPPFSQQPPISQQQQPPFSQQQQPQFSQQQQPPYSQQQQPPYSQQ 112
Query  55   Q--PFLPQL--PYPQPQPFPP----QQSYPQPQP--QYPQP----QQPISQQQAQ--LQQ 98
            Q  PF  Q   P+ Q Q  PP    QQ   Q QP  Q  QP    Q PISQQQ    LQQ
Sbjct  113  QQPPFSQQQQPPFSQQQQQPPFTQQQQQQQQQQPFTQQQQPPFSQQPPISQQQQPPFLQQ 172
Query  99   QQ----QQQQQQILQQILQQQLIPCRDVVLQQPNIA------HASSQVSQQSY-QLLQQL 147
            Q+    +QQQ  +++  + QQL PC+ V LQQ  I        A SQ+ QQS  +++QQ 
Sbjct  173  QRPPFSRQQQIPVIHPSVLQQLNPCK-VFLQQQCIPVAMQRCLARSQMLQQSICHVMQQQ 231
Query  148  CCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQ 207
            CCQQL Q PEQSR ++I  +I++IIL  QQQQQQQQQQQQQQ Q   Q QQQQ QQ    
Sbjct  232  CCQQLRQIPEQSRHESIRAIIYSIIL--QQQQQQQQQQQQQQGQSIIQYQQQQPQQLGQC 289
Query  208  VSYQQPQQQYPSGQGSFQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPY 267
            VS  QP QQ     G      Q PQ Q + +  Q+ Q+E + ++AL+TLP MCNV +P Y
Sbjct  290  VS--QPLQQLQQQLG------QQPQQQQLAH--QIAQLEVMTSIALRTLPTMCNVNVPLY 339
Query  268  CSTTIAPFGI 277
             +TT  P+G+
Sbjct  340  ETTTSVPLGV 349

Sequence Alignment: 25. Allergen Name: Tri a gliadin Sequence ID: AAA34272

 Score = 63.4 bits 585,  Expect = 1e-11
 Identities = 131/230 56%, Positives = 162/230 70%, Gaps = 69/230 30%
Query  4    PVPQLQPQNPSQQQPQEQVPLVQQ------QQFLGQQQQHFPGQ-QQPFP----PQQPYP 52
            P PQ  PQ P  QQPQ  +P  +Q      QQ + Q QQ +P Q QQ FP    PQQP+P
Sbjct  36   PFPQ--PQQPFCQQPQRTIPQPHQTFHHQPQQTFPQPQQTYPHQPQQQFPQTQQPQQPFP 93
Query  53   QPQ---PFLPQLPYPQ-PQ-PFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQ------ 101
            QPQ   P  PQLP+PQ PQ PFP  Q   QP PQ  QPQQP  Q Q Q+ Q QQ      
Sbjct  94   QPQQTFPQQPQLPFPQQPQQPFPQPQQPQQPFPQSQQPQQPFPQPQQQFPQPQQPQQSFP 153
Query  102  QQQQQILQQILQQQLIPCRDVVLQQPN-IAHASSQVS----QQSYQLLQQLCCQQLWQTP 156
            QQQQ  +Q  LQQQ+ PC++ +LQQ N ++  SS VS    +   Q++QQ CCQQL Q P
Sbjct  154  QQQQPAIQSFLQQQMNPCKNFLLQQCNHVSLVSSLVSIILPRSDCQVMQQQCCQQLAQIP 213
Query  157  EQSRCQAIHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQ 216
            +Q +C AIH+V H+II+                      QQ+QQQ  P            
Sbjct  214  QQLQCAAIHSVAHSIIM----------------------QQEQQQGVPI----------- 240
Query  217  YPSGQGSFQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPF 275
                   ++P  Q  Q  G +QPQQ  Q+E IR+L L+TLP MCNVY+PP CST   P+
Sbjct  241  -------LRPLFQLAQGLGIIQPQQPAQLEGIRSLVLKTLPTMCNVYVPPDCSTINVPY 292

Sequence Alignment: 26. Allergen Name: Tri a glutenin Sequence ID: CAA31685

 Score = 63.3 bits 584,  Expect = 1e-11
 Identities = 131/251 52%, Positives = 168/251 66%, Gaps = 36/251 14%
Query  7    QLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQP-YPQPQPFLPQLPYPQ 65
            Q QP  P Q  PQ+ +   QQQQ L  QQ  F  QQ PF  QQP + Q QP LPQ P   
Sbjct  34   QQQPLPPQQTFPQQPLFSQQQQQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQP--- 90
Query  66   PQPFPPQQSYPQPQ-PQYPQPQQPI-SQQQAQLQQQQQQQQQQILQQI------LQQQLI 117
              PF  QQ    PQ P + Q QQP+   QQ+ + QQQQQ+QQ + QQI      + QQL 
Sbjct  91   --PFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQPSILQQLN 148
Query  118  PCRDVVLQQPN--IAH----ASSQVSQQSY-QLLQQLCCQQLWQTPEQSRCQAIHNVIHA 170
            PC+ V LQQ    +A     A SQ+ QQS  +++QQ CCQQL Q P+QSR +AI  +I++
Sbjct  149  PCK-VFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYS 207
Query  171  IILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQN 230
            IIL+ QQQ Q   Q QQQQ QQ  Q   Q QQQ   Q+  QQPQQQ  + QG+F      
Sbjct  208  IILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLG-QQPQQQQLA-QGTF------ 259
Query  231  PQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGI 277
                  +QP+Q+ Q+E + ++AL+ LP MC+V +P Y +TT  PFG+
Sbjct  260  ------LQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGV 300

Sequence Alignment: 27. Allergen Name: Tri a 20.0101 Sequence ID: BAN29066

 Score = 63.0 bits 581,  Expect = 1e-11
 Identities = 135/235 57%, Positives = 166/235 70%, Gaps = 55/235 23%
Query  4    PVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQP----FPPQQPYPQPQPFLP 59
            PVPQ  P+ P  QQPQ+  P   QQ F  Q QQ+FP  QQP    + PQQP+PQ     P
Sbjct  17   PVPQ--PHQPFSQQPQQTFPQ-PQQTFPHQPQQQFPQPQQPQQQFLQPQQPFPQQ----P 69
Query  60   QLPYPQ-PQ-PFP----PQQSYPQ---PQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQ 110
            Q PYPQ PQ PFP    PQQ +PQ   PQ Q+ QPQQ   Q Q Q QQ   QQQ   +Q 
Sbjct  70   QQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQ-QPQQSFPQQQPPFIQP 128
Query  111  ILQQQLIPCRDVVLQQ-PNIAHASSQVS----QQSYQLLQQLCCQQLWQTPEQSRCQAIH 165
             LQQQ+ PC++ +LQQ   ++  SS  S    Q   Q+++Q CCQQL Q P+Q +C AIH
Sbjct  129  SLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIH 188
Query  166  NVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQ 225
             +IH+II+               QQ+QQ+QQQ  +   P     YQQ Q     GQG++ 
Sbjct  189  TIIHSIIM---------------QQEQQEQQQGMHILLPL----YQQQQ----VGQGTLV 225
Query  226  PSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPF 275
                  Q QG +QPQQ  Q+E IR+L LQTLP MCNVY+PP CS   APF
Sbjct  226  ------QGQGIIQPQQPAQLEAIRSLVLQTLPTMCNVYVPPECSIIKAPF 269

Sequence Alignment: 28. Allergen Name: Tri a gliadin Sequence ID: AAA34288

 Score = 62.6 bits 577,  Expect = 2e-11
 Identities = 101/187 54%, Positives = 128/187 68%, Gaps = 26/187 13%
Query  4    PVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQP----FPPQQPYPQPQPFLP 59
            PVPQ  P+ P  QQPQ+  P   QQ F  Q QQ+FP  QQP    + PQQP+PQ     P
Sbjct  36   PVPQ--PHQPFSQQPQQTFPQ-PQQTFPHQPQQQFPQPQQPQQQFLQPQQPFPQQ----P 88
Query  60   QLPYPQ-PQ-PFP----PQQSYPQ---PQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQ 110
            Q PYPQ PQ PFP    PQQ +PQ   PQ Q+ QPQQ   Q Q Q QQ   QQQ   +Q 
Sbjct  89   QQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQ-QPQQSFPQQQPPFIQP 147
Query  111  ILQQQLIPCRDVVLQQ-PNIAHASSQVS----QQSYQLLQQLCCQQLWQTPEQSRCQAIH 165
             LQQQ+ PC++ +LQQ   ++  SS  S    Q   Q+++Q CCQQL Q P+Q +C AIH
Sbjct  148  SLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIH 207
Query  166  NVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQ 198
             +IH+II++++QQ+QQQ  +      QQQQ  Q
Sbjct  208  TIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQ 240

Sequence Alignment: 29. Allergen Name: Tri a gliadin Sequence ID: BAA11251

 Score = 62.4 bits 574,  Expect = 2e-11
 Identities = 137/234 58%, Positives = 169/234 72%, Gaps = 57/234 24%
Query  4    PVPQ-LQP--QNPSQQ--QPQEQVPLVQQQQFLGQQQ--QHFPGQQQPFP--PQQPYPQ- 53
            P PQ  QP  Q P Q   QPQ+  P   QQQF   QQ  Q+F   QQPFP  PQQ YPQ 
Sbjct  17   PFPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFSQPQQPQQQFIQPQQPFPQQPQQTYPQR 76
Query  54   PQPFLPQLPYPQPQPFP----PQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQ 109
            PQ  +PQ   PQ QPFP    PQQ +PQPQ Q+PQPQQP        QQ   QQQ  ++Q
Sbjct  77   PQQPFPQTQQPQ-QPFPQSQQPQQPFPQPQQQFPQPQQP--------QQSFPQQQPSLIQ 127
Query  110  QILQQQLIPCRDVVLQQ-PNIAHASSQVS----QQSYQLLQQLCCQQLWQTPEQSRCQAI 164
            Q LQQQL PC++ +LQQ   ++  SS  S    +   Q+++Q CCQQL Q P+Q +C AI
Sbjct  128  QSLQQQLNPCKNFLLQQCKPVSLVSSLWSMILPRSDCQVMRQQCCQQLAQIPQQLQCAAI 187
Query  165  HNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSF 224
            H+++H+II+               QQ+QQ+Q+Q  Q   P SQ      QQQ   GQG++
Sbjct  188  HSIVHSIIM---------------QQEQQEQRQGVQILVPLSQ------QQQV--GQGTL 224
Query  225  QPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPF 275
                   Q QG +QPQQ  Q+E IR+  LQTL  MCNVY+PPYCST  APF
Sbjct  225  V------QGQGIIQPQQPAQLEVIRSSVLQTLATMCNVYVPPYCSTIRAPF 269

Sequence Alignment: 30. Allergen Name: Tri a gliadin Sequence ID: AAA34274

 Score = 62.2 bits 572,  Expect = 2e-11
 Identities = 137/236 58%, Positives = 164/236 69%, Gaps = 44/236 18%
Query  6    PQLQPQNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQPYPQP-QPF--LPQLP 62
            P LQP+ P  QQPQ+  P   QQ F  Q QQ+FP   QP  PQQ + QP QPF   PQ P
Sbjct  36   PFLQPHQPFSQQPQQIFPQ-PQQTFPHQPQQQFP---QPQQPQQQFLQPRQPFPQQPQQP 91
Query  63   YPQ-PQ-PFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQILQQQLIPCR 120
            YPQ PQ PFP  Q   QP PQ  QPQQP  Q Q Q QQ   QQQ  ++QQ LQQQL PC+
Sbjct  92   YPQQPQQPFPQTQQPQQPFPQSKQPQQPFPQPQ-QPQQSFPQQQPSLIQQSLQQQLNPCK 150
Query  121  DVVLQQ-PNIAHASSQVS----QQSYQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHH 175
            + +LQQ   ++  SS  S        Q+++Q CCQQL Q P+Q +C AIH+V+H+II+  
Sbjct  151  NFLLQQCKPVSLVSSLWSIILPPSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIM-- 208
Query  176  QQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQG 235
                         QQ+QQ+Q Q  Q   P SQ      QQQ   GQG +       Q QG
Sbjct  209  -------------QQEQQEQLQGVQILVPLSQ------QQQV--GQGILV------QGQG 241
Query  236  FVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPF 275
             +QPQQ  Q+E IR+L LQTLP MCNVY+PPYCST  APF
Sbjct  242  IIQPQQPAQLEVIRSLVLQTLPTMCNVYVPPYCSTIRAPF 281

Sequence Alignment: 31. Allergen Name: Tri a glutenin Sequence ID: CAA59338

 Score = 59.2 bits 537,  Expect = 2e-10
 Identities = 108/195 55%, Positives = 128/195 65%, Gaps = 22/195 11%
Query  13   PSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQP-YPQPQPFLPQLPYPQPQPFPP 71
            P  ++P +Q PL   QQ L  QQQ FP QQ PF  QQP + Q QP     P+ Q QP  P
Sbjct  21   PGLERPWQQQPL-PPQQTLFPQQQPFPQQQPPFSQQQPSFSQQQP-----PFSQQQPILP 74
Query  72   QQSYP-QPQPQYPQPQQPISQQQAQLQQQQQQQ--QQQI--LQQILQQQLIPCRDVVLQQ 126
            +  +  Q QP  PQ Q P SQQQ  L  QQQQQ  QQQI  +Q  + QQL PC+ V LQQ
Sbjct  75   EPPFSLQQQPVLPQ-QSPFSQQQLVLPPQQQQQLPQQQISIVQPSVLQQLNPCK-VFLQQ 132
Query  127  PN--IAH----ASSQVSQQSY-QLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQ 179
                +A     A SQ+ QQS  +++QQ CCQQL Q PEQSR  AI  + ++IIL+ QQQ 
Sbjct  133  QCSPVAMPQRLARSQMWQQSRCHVMQQQCCQQLSQIPEQSRYDAICAITYSIILQEQQQG 192
Query  180  -QQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQ 215
              Q QQQQ QQ  Q   Q QQQ QQ   Q S+QQPQQ
Sbjct  193  FVQAQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQ 229

Sequence Alignment: 32. Allergen Name: Tri a glutenin Sequence ID: CAA59340

 Score = 58.6 bits 529,  Expect = 3e-10
 Identities = 105/205 51%, Positives = 133/205 64%, Gaps = 29/205 14%
Query  6    PQLQPQNP--SQQQP---QEQVPLVQQQQFLGQQQQ-HFPGQQQPFPPQQPYPQPQPFLP 59
            P  Q Q P  SQQQP   Q+++P++ QQ  + QQQQ +F  QQQPFP QQ   QP  +L 
Sbjct  48   PLSQQQQPPFSQQQPPFSQQELPILPQQPPFSQQQQPQFSQQQQPFPQQQ---QPL-LLQ 103
Query  60   QLPYPQPQP-FPPQQSYP----QPQPQYPQPQQPISQQQAQLQQQQQ----QQQQQILQQ 110
            Q P+ Q +P F  QQ  P    QP     Q QQPI  QQ  +  +QQ    QQQ   +Q 
Sbjct  104  QPPFSQQRPPFSQQQQQPVLPQQPPFSQQQQQQPILPQQPPFSLHQQPVLPQQQIPYVQP 163
Query  111  ILQQQLIPCRDVVLQQ-------PNIAHASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQA 163
             + QQL PC+ V LQQ       P     S  + Q S +++QQ CCQQL + PEQSR  A
Sbjct  164  SILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLWQSSCHVMQQQCCQQLPRIPEQSRYDA 222
Query  164  IHNVIHAIILHHQQQQQ--QQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQ 215
            I  +I++I+L+ QQ+ Q   Q QQQQ QQ  Q   Q QQQQ+   Q S+QQPQQ
Sbjct  223  IRAIIYSIVLQEQQHGQGFNQPQQQQPQQSVQGVSQPQQQQKQLGQCSFQQPQQ 276

Sequence Alignment: 33. Allergen Name: Tri a gliadin Sequence ID: AAA34287

 Score = 55.4 bits 492,  Expect = 2e-09
 Identities = 117/230 50%, Positives = 151/230 65%, Gaps = 37/230 16%
Query  18   PQEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQPYPQPQPFLPQLPYPQPQPFPPQQSYPQ 77
            PQ+  PL  QQ FL Q QQ F   QQP   QQP PQPQ  + Q+  P      P    P 
Sbjct  1    PQQPFPLQPQQSFLWQSQQPF--LQQP---QQPSPQPQQVV-QIISPATPTTIPSAGKPT 54
Query  78   PQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQILQQQLIPCRDVVLQQPN--IAH---- 131
              P +PQ QQ         +QQ  QQQ  ++Q  + QQL PC+ V LQQ    +A     
Sbjct  55   SAP-FPQQQQQ--------HQQLAQQQIPVVQPSILQQLNPCK-VFLQQQCSPVAMPQRL 104
Query  132  ASSQVSQQSY-QLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQQQQQQQQQQQQ 190
            A SQ+ QQS  +++QQ CCQQL Q P+QSR QAI  +I++IIL+ QQQ Q   Q QQQQ 
Sbjct  105  ARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYQAIRAIIYSIILQEQQQVQGSIQSQQQQP 164
Query  191  QQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQGFVQPQQLPQFEEIRN 250
            QQ  Q   Q QQQ   Q+  QQPQQQ  + QG+F            +QP+Q+ Q+E + +
Sbjct  165  QQLGQCVSQPQQQSQQQLG-QQPQQQQLA-QGTF------------LQPHQIAQLEVMTS 210
Query  251  LALQTLPAMCNVYIPPYCSTTIAPFGI 277
            +AL+ LP MC+V +P Y +TT  PFG+
Sbjct  211  IALRILPTMCSVNVPLYRTTTSVPFGV 237

Sequence Alignment: 34. Allergen Name: Tri a glutenin Sequence ID: CAA59339

 Score = 49.8 bits 426,  Expect = 1e-07
 Identities = 109/208 52%, Positives = 133/208 63%, Gaps = 24/208 11%
Query  4    PVPQLQPQNPSQQQP----QEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQP-YPQPQ-PF 57
            P PQ QP    QQQP    Q+Q P+ QQQ  + QQQQ    QQ PF  QQ  +PQ Q P+
Sbjct  34   PFPQ-QPPCSQQQQPPLSQQQQPPFSQQQPPFSQQQQPILPQQPPFSQQQQQFPQQQQPL 92
Query  58   LPQLP-YPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQ--QQQQI--LQQIL 112
            LPQ P + Q QP P  Q   QP P   Q QQPI  QQ  + Q+QQ    QQQI  +Q  +
Sbjct  93   LPQQPPFSQQQP-PFSQQQQQP-PFSQQQQQPILLQQPPFSQHQQPVLPQQQIPSVQPSI 150
Query  113  QQQLIPCRDVVLQQ-------PNIAHASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQAIH 165
             QQL PC+ V LQQ       P     S  + Q S +++QQ CC+QL Q PEQSR  AI 
Sbjct  151  LQQLNPCK-VFLQQQCSPVAMPQSLARSQMLWQSSCHVMQQQCCRQLPQIPEQSRYDAIR 209
Query  166  NVIHAIILHHQQQQQQQQQQQQQQQQQQQQ--QQQQQQQQPSSQVSYQQPQQ 215
             +I++I+L+ QQ+ Q   Q QQQQ QQ  Q   Q QQQQ+   Q S+QQPQQ
Sbjct  210  AIIYSIVLQEQQHGQGLNQPQQQQPQQSVQGVSQPQQQQKQLGQCSFQQPQQ 261

Sequence Alignment: 35. Allergen Name: Hor v 20.0101 Sequence ID: P80198

 Score = 48.4 bits 409,  Expect = 4e-07
 Identities = 125/242 51%, Positives = 161/242 66%, Gaps = 51/242 21%
Query  4    PVPQLQP---QNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQPFP---PQQPYPQPQPF 57
            P+PQ  P   Q P Q  PQ+Q PL QQQ F   QQ ++P Q+Q FP   PQQ +PQ  P+
Sbjct  27   PLPQQPPFLQQEPEQPYPQQQ-PLPQQQPF--PQQPQLPHQHQ-FPQQLPQQQFPQQMPL 82
Query  58   LPQLPYPQPQPFPPQQS--YPQPQP--QYPQP--QQPISQQQAQLQQQ---QQQQQQQIL 108
             PQ  +PQ  P+ PQQ   +PQ +P  QY QP  QQP  QQQ   QQQ   ++Q+Q  + 
Sbjct  83   QPQQQFPQQMPLQPQQQPQFPQQKPFGQYQQPLTQQPYPQQQPLAQQQPSIEEQHQLNLC 142
Query  109  QQILQQQLIPCRDVVLQQPNIAHASSQVSQQ-SYQLLQQLCCQQLWQTPEQSRCQAIHNV 167
            ++ L QQ      V L Q  I+    ++SQQ S QL +Q CCQQL    EQSRC AI+ +
Sbjct  143  KEFLLQQCTLDEKVPLLQSVISFLRPHISQQNSCQLKRQQCCQQLANINEQSRCPAIQTI 202
Query  168  IHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPS 227
            +HAI++      QQQ QQQ  +   Q Q QQ  Q  P   +  QQ            QP 
Sbjct  203  VHAIVM------QQQVQQQVGHGFVQSQLQQLGQGMP---IQLQQ------------QPG 241
Query  228  QQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFST 280
            Q       FV PQQ  QF+ + +L +QTLP +CNV++PPYCS    PFG  +T
Sbjct  242  Q------AFVLPQQQAQFKVVGSLVIQTLPMLCNVHVPPYCS----PFGSMAT 284

Sequence Alignment: 36. Allergen Name: Hor v 21 Sequence ID: P80198

 Score = 48.4 bits 409,  Expect = 4e-07
 Identities = 125/242 51%, Positives = 161/242 66%, Gaps = 51/242 21%
Query  4    PVPQLQP---QNPSQQQPQEQVPLVQQQQFLGQQQQHFPGQQQPFP---PQQPYPQPQPF 57
            P+PQ  P   Q P Q  PQ+Q PL QQQ F   QQ ++P Q+Q FP   PQQ +PQ  P+
Sbjct  27   PLPQQPPFLQQEPEQPYPQQQ-PLPQQQPF--PQQPQLPHQHQ-FPQQLPQQQFPQQMPL 82
Query  58   LPQLPYPQPQPFPPQQS--YPQPQP--QYPQP--QQPISQQQAQLQQQ---QQQQQQQIL 108
             PQ  +PQ  P+ PQQ   +PQ +P  QY QP  QQP  QQQ   QQQ   ++Q+Q  + 
Sbjct  83   QPQQQFPQQMPLQPQQQPQFPQQKPFGQYQQPLTQQPYPQQQPLAQQQPSIEEQHQLNLC 142
Query  109  QQILQQQLIPCRDVVLQQPNIAHASSQVSQQ-SYQLLQQLCCQQLWQTPEQSRCQAIHNV 167
            ++ L QQ      V L Q  I+    ++SQQ S QL +Q CCQQL    EQSRC AI+ +
Sbjct  143  KEFLLQQCTLDEKVPLLQSVISFLRPHISQQNSCQLKRQQCCQQLANINEQSRCPAIQTI 202
Query  168  IHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPS 227
            +HAI++      QQQ QQQ  +   Q Q QQ  Q  P   +  QQ            QP 
Sbjct  203  VHAIVM------QQQVQQQVGHGFVQSQLQQLGQGMP---IQLQQ------------QPG 241
Query  228  QQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFST 280
            Q       FV PQQ  QF+ + +L +QTLP +CNV++PPYCS    PFG  +T
Sbjct  242  Q------AFVLPQQQAQFKVVGSLVIQTLPMLCNVHVPPYCS----PFGSMAT 284

Sequence Alignment: 37. Allergen Name: Tri a 36.0101 Sequence ID: AEH31546

 Score = 46.4 bits 386,  Expect = 2e-06
 Identities = 139/257 54%, Positives = 173/257 67%, Gaps = 48/257 18%
Query  6    PQLQPQNP--SQQQP----QEQVPLVQQQQF-LGQQQQHFPGQQQP-FPPQQP--YPQPQ 55
            P  Q Q P  SQQQP    Q+Q PL QQQQ  + QQQ  F  QQQP F  QQP    Q Q
Sbjct  73   PLSQQQQPPFSQQQPPFSQQQQQPLSQQQQPPFSQQQPPFSQQQQPPFSQQQPPFSQQQQ 132
Query  56   PFLPQLPYPQPQPFPP--QQSYP---------QPQPQYPQPQQPISQQQAQLQQQQQQ-- 102
            P LPQ P    Q +PP  QQ  P         Q QP + Q QQP   QQ  + QQQQQ  
Sbjct  133  PVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQPPFLQQQQPSLPQQPPFSQQQQQLV 192
Query  103  -QQQQI--LQQILQQQLIPCRDVVLQQPN--IAH----ASSQVSQQSY-QLLQQLCCQQL 152
              QQQI  ++  + QQL PC+ V LQQ    +A     A SQ+ QQS  +++QQ CCQQL
Sbjct  193  LPQQQIPFVHPSILQQLNPCK-VFLQQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQL 251
Query  153  WQTPEQSRCQAIHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQ 212
             Q P+QSR +AI  +I++IIL+ QQQ Q   Q  QQQ QQ  Q   Q QQQ   Q+  QQ
Sbjct  252  PQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQTPQQQPQQLGQCVSQPQQQSQQQLG-QQ 310
Query  213  PQQQYPSGQGSFQPSQQNPQAQGFVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTI 272
            PQQQ  + QG+F            +QP+Q+ Q+E + ++AL+TLP MC V +P Y +TT 
Sbjct  311  PQQQQLA-QGTF------------LQPHQIAQLEVMTSIALRTLPTMCRVNVPLYRTTTS 357
Query  273  APFGI 277
             PFG+
Sbjct  358  VPFGV 362

Sequence Alignment: 38. Allergen Name: Tri a glutenin Sequence ID: CAA31395

 Score = 43.6 bits 350,  Expect = 3e-05
 Identities = 98/212 46%, Positives = 107/212 50%, Gaps = 35/212 16%
Query  7    QLQPQNPSQ--QQP-QEQVP-LVQQQQFLGQQQQ-HFPGQQQP--FP--PQQPYPQPQPF 57
            QLQ     Q  QQP Q Q P   QQ Q  GQ QQ + PGQ QP  +P  PQQ     QP 
Sbjct  452  QLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQQPG 511
Query  58   LPQLP-YPQPQPFPPQQSYP-QPQPQY-P-QPQQP-ISQQQAQLQQQQQQQQQQILQQIL 112
              Q P   QP  +P     P Q QP Y P  PQQP   QQ  QLQQ  Q QQ Q L Q  
Sbjct  512  QWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQQPGQLQQPAQGQQGQQLAQGQ 571
Query  113  QQQLIPCRDVVLQQPNIAHASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQAIHNVIHAII 172
            Q Q  P +    QQP   +   Q+ Q   Q  QQ    Q  Q P Q +            
Sbjct  572  QGQQ-PAQVQQGQQPAQGQQGQQLGQG--QQGQQPGQGQQGQQPAQGQ------------ 616
Query  173  LHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQ 232
               Q QQ  Q Q+ QQ  Q QQ QQ  Q QQP     +  P     SGQG  QP Q    
Sbjct  617  ---QGQQPGQGQHGQQPGQGQQGQQPGQGQQPGQGQPWYYPTSPQESGQGQ-QPGQWQQP 672
Query  233  AQGFVQP 239
             QG  QP
Sbjct  673  GQG--QP 677

Sequence Alignment: 39. Allergen Name: Tri a glutenin Sequence ID: CAA43331

 Score = 43.0 bits 343,  Expect = 4e-05
 Identities = 101/235 42%, Positives = 109/235 46%, Gaps = 22/235 9%
Query  6    PQLQPQNPSQQQPQEQVPLVQQQQFLGQQ-QQHFPGQQQPFPPQ-----QPYPQPQPFLP 59
            P+  P +P QQ  QEQ P   QQ   GQQ QQ   GQQ   P Q     QP    Q   P
Sbjct  394  PRYYPTSP-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQQP 452
Query  60   QLPYPQPQPFPPQQSYPQPQP-QYP-QPQQPIS-QQQAQLQQQQQQQQ-QQILQQILQQQ 115
                P   P  PQQS  Q QP  YP  PQQ    QQ AQ QQ  Q+QQ QQ  Q    QQ
Sbjct  453  GQGQPGYYPTSPQQS-GQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQGQQPGQGQQGQQ 511
Query  116  LIPCRDVVLQQPNIAHASSQVSQQSYQLLQ-QLCCQ-QLWQTPEQSRCQAIHNVIHAIIL 173
                +     QP     S Q S Q  QL Q Q   Q Q  + P  S  Q  +        
Sbjct  512  PGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQPGHYPT-SPLQPGQGQPGYYPT 570
Query  174  HHQQ----QQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQ-QYPS-GQGSFQPS 227
              QQ    QQ  Q QQ  Q QQ QQ  Q QQ QQP      QQP Q Q P  GQ  + P+
Sbjct  571  SPQQIGQGQQPGQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPT 630
Query  228  QQNPQAQGFVQPQQLPQ 244
                  QG  QP Q  Q
Sbjct  631  SLQQSGQG-QQPGQWQQ 646

Sequence Alignment: 40. Allergen Name: Tri a 26.0101 Sequence ID: P10388

 Score = 42.5 bits 338,  Expect = 6e-05
 Identities = 98/212 46%, Positives = 107/212 50%, Gaps = 35/212 16%
Query  7    QLQPQNPSQ--QQP-QEQVP-LVQQQQFLGQQQQ-HFPGQQQP--FP--PQQPYPQPQPF 57
            QLQ     Q  QQP Q Q P   QQ Q  GQ QQ + PGQ QP  +P  PQQ     QP 
Sbjct  452  QLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQQPG 511
Query  58   LPQLP-YPQPQPFPPQQSYP-QPQPQY-P-QPQQP-ISQQQAQLQQQQQQQQQQILQQIL 112
              Q P   QP  +P     P Q QP Y P  PQQP   QQ  QLQQ  Q QQ Q L Q  
Sbjct  512  QWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQQPGQLQQPAQGQQGQQLAQGQ 571
Query  113  QQQLIPCRDVVLQQPNIAHASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQAIHNVIHAII 172
            Q Q  P +    QQP   +   Q+ Q   Q  QQ    Q  Q P Q +            
Sbjct  572  QGQQ-PAQVQQGQQPAQGQQGQQLGQG--QQGQQPGQGQQGQQPAQGQ------------ 616
Query  173  LHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQ 232
               Q QQ  Q Q+ QQ  Q QQ QQ  Q QQP     +  P     SGQG  QP Q    
Sbjct  617  ---QGQQPGQGQHGQQPGQGQQGQQPGQGQQPGQGQPWYYPTSPQESGQGQ-QPGQWQQP 672
Query  233  AQGFVQP 239
             QG  QP
Sbjct  673  GQG--QP 677

Sequence Alignment: 41. Allergen Name: Tri a glutenin Sequence ID: CAA27052

 Score = 42.0 bits 332,  Expect = 9e-05
 Identities = 93/212 43%, Positives = 101/212 47%, Gaps = 27/212 12%
Query  10   PQNPSQ-QQP-QEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQPYPQPQPFLPQLPYPQPQ 67
            PQ P Q QQP Q Q P   QQ   GQQ Q+ PGQ Q    QQP    QP   Q   P   
Sbjct  314  PQQPGQGQQPGQLQQPAQGQQPEQGQQGQQ-PGQGQ--QGQQPGQGQQPGQGQ---PGYY 367
Query  68   PFPPQQSYPQPQP-QYP-QPQQPI-SQQQAQLQQQQQQQQQQILQQILQQQLIPCRDVVL 124
            P  PQQS  Q QP  YP   QQP  SQQ  Q QQ QQ  Q Q  QQ  Q Q  P +    
Sbjct  368  PTSPQQS-GQGQPGYYPTSSQQPTQSQQPGQGQQGQQVGQGQQAQQPGQGQQ-PGQGQPG 425
Query  125  QQPNIAHASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIILHHQQQQQQQQQ 184
              P     S Q  Q  Y L           +P+QS        ++     ++ QQ  Q Q
Sbjct  426  YYPTSPLQSGQ-GQPGYYLT----------SPQQSGQGQQPGQLQQSAQGQKGQQPGQGQ 474
Query  185  QQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQQYPSGQGSFQPSQQNPQAQGFVQPQQLP 243
            Q  Q QQ QQ  Q QQ QQP        P     SGQG  QP Q     QG  QP   P
Sbjct  475  QPGQGQQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQ-QPGQWQQPGQG--QPGYYP 530

Sequence Alignment: 42. Allergen Name: Tri a glutenin Sequence ID: AAB02788

 Score = 41.3 bits 323,  Expect = 0.0001
 Identities = 98/230 42%, Positives = 105/230 45%, Gaps = 23/230 10%
Query  6    PQLQPQNPSQQQPQEQVPLVQQQQFLGQQ-QQHFPGQQ-----QPFPPQQPYPQPQPFLP 59
            P+  P +P QQ  QEQ P   QQ   GQQ QQ   GQQ     Q    QQP    Q   P
Sbjct  388  PRYYPTSP-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQQRQGEQGQQPGQGQQGQQP 446
Query  60   QLPYPQPQPFPPQQSYPQPQPQYPQPQQPISQQQAQLQQQQQQQQQQILQQILQQQLIPC 119
                P   P  PQQS  Q QP Y  P  P  QQ  QLQQ  Q QQ    QQ   QQ    
Sbjct  447  GQGQPGYYPTSPQQS-GQGQPGY-YPTSP--QQSGQLQQPAQGQQPGQEQQ--GQQPGQG 500
Query  120  RDVVLQQPNIAHASSQVSQQSYQLLQ-QLCCQ-QLWQTPEQSRCQAIHNVIHAIILHHQQ 177
            +     QP     S Q S Q  QL Q Q   Q Q  + P  S  Q  +          QQ
Sbjct  501  QQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQPGHYPT-SPLQPGQGQPGYYPTSPQQ 559
Query  178  ----QQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQ-QYPS-GQGSFQPSQQNP 231
                QQ  Q QQ  Q QQ QQ  Q QQ QQP      QQP Q Q P  GQ  + P+    
Sbjct  560  IGQGQQPGQLQQPTQGQQGQQPGQGQQGQQPGEGQQGQQPGQGQQPGQGQPGYYPTSLQQ 619
Query  232  QAQGFVQPQQLPQ 244
              QG  QP Q  Q
Sbjct  620  SGQG-QQPGQWQQ 631
 Score = 40.8 bits 318,  Expect = 0.0002
 Identities = 93/226 41%, Positives = 113/226 50%, Gaps = 37/226 16%
Query  10   PQNPSQQQPQEQVPLVQQQQFLG----QQQQHFPGQ---QQPFPPQQPY----PQPQPFL 58
            P    QQ     +P + ++ +L     QQ  ++PGQ   Q+P   QQ Y    PQ     
Sbjct  90   PPQQLQQSILWGIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQEYYLTSPQQSGQW 149
Query  59   PQLPYPQPQPFP--PQQSYPQPQP-QYP-QPQQPIS-QQQAQLQQQQQQQQQQILQQILQ 113
             Q    Q   +P  PQQS  Q QP  YP  P QP   QQ  Q QQ+QQ  Q Q L+Q  Q
Sbjct  150  QQPGQGQSGYYPTSPQQS-GQKQPGYYPTSPWQPEQLQQPTQGQQRQQPGQGQQLRQGQQ 208
Query  114  QQLIPCRDVVLQQPNIAHASSQVSQQSYQLLQQLCCQQLWQTPEQSRCQAIHNVIHAIIL 173
             Q          QP     SSQ   Q    LQQL   Q  Q PE  R Q  +   +   L
Sbjct  209  GQ-----QSGQGQPRYYPTSSQQPGQ----LQQLAQGQQGQQPE--RGQQGQQSGQGQQL 257
Query  174  HHQQQQQQQQQQQQQQQQQQ------QQQQQQQQQQPSSQVSYQQPQ-QQYPSGQGSFQP 226
             + QQ QQ  Q+QQ  Q QQ       QQ  Q QQ    Q+ Y     QQ   GQ  + P
Sbjct  258  GQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSGQGQLGYYPTSPQQSGQGQSGYYP 317
Query  227  S--QQNPQAQGFVQPQQLPQFEE 247
            +  QQ  Q Q   Q QQL Q ++
Sbjct  318  TSAQQPGQLQQSTQEQQLGQEQQ 340

Sequence Alignment: 43. Allergen Name: Tri a glutenin Sequence ID: CAA26847

 Score = 40.1 bits 310,  Expect = 0.0003
 Identities = 100/240 41%, Positives = 113/240 47%, Gaps = 32/240 13%
Query  4    PVPQLQPQNP-SQQQP----QEQVPLVQQQQFLGQQQQHFPG-QQQPFPPQQ---PYPQP 54
            P    Q + P SQQQP    Q + P  QQQ   GQQ  H+P  QQ+P   QQ   P  Q 
Sbjct  299  PAQGQQGHYPASQQQPGQGQQGHYPASQQQPGQGQQG-HYPASQQEPGQGQQGQIPASQQ 357
Query  55   QPFLPQLP-YPQPQPFPPQQS-YPQPQPQYPQPQQ---PISQQQ-AQLQQQQQQQQQQIL 108
            QP   Q   YP     P QQ  YP    Q  Q QQ   P  +QQ  Q QQ  Q QQ +  
Sbjct  358  QPGQGQQGHYPASLQQPGQQGHYPTSLQQLGQGQQIGQPGQKQQPGQGQQTGQGQQPEQE 417
Query  109  QQILQQQLIPCRDVVLQQPNIAHASSQVSQQSY---QLLQQLCCQQ-----LWQTPEQSR 160
            QQ  Q Q        LQQP   +   Q  QQ Y    L Q    QQ       Q P Q +
Sbjct  418  QQPGQGQQ-GYYPTSLQQPGQGQQQGQ-GQQGYYPTSLQQPGQGQQGHYPASLQQPGQGQ 475
Query  161  CQAIHNVIHAIILHHQQQQQQQQQQQ----QQQQQQQQQQQQQQQQQPSSQVSYQQPQQQ 216
             Q  +        H +Q QQ  Q QQ       QQ  Q QQ  Q QQ     S QQP Q 
Sbjct  476  GQPGQRQQPGQGQHPEQGQQPGQGQQGYYPTSPQQPGQGQQLGQGQQGYYPTSPQQPGQG 535
Query  217  YPSGQGSFQPSQQNPQAQGFVQPQQLPQFEEI 248
               GQG       +PQ  G  Q QQL Q ++I
Sbjct  536  QQPGQGQQGHCPMSPQQTG--QAQQLGQGQQI 565

Sequence Alignment: 44. Allergen Name: Tri a glutenin Sequence ID: CAA43361

 Score = 40.1 bits 310,  Expect = 0.0003
 Identities = 99/239 41%, Positives = 118/239 49%, Gaps = 38/239 15%
Query  4    PVPQLQP------QNP-SQQQP----QEQVPLVQQQQFLGQQQQHFPGQQQPFPPQQ-PY 51
            P  Q QP      Q P SQQQP    Q Q P  QQQ   GQQ +++  QQQP   QQ  Y
Sbjct  314  PASQQQPGQGQQGQYPASQQQPGQGQQGQYPASQQQPGQGQQGHYLASQQQPGQGQQRHY 373
Query  52   PQP--QPFLPQLPY---PQPQPFPPQQS-YP-------QPQP--QYPQPQQPISQQQA-- 94
            P    QP   Q  +      QP   QQ  YP       Q Q   Q  Q QQP   QQ   
Sbjct  374  PASLQQPGQGQQGHYTASLQQPGQGQQGHYPASLQQVGQGQQIGQLGQRQQPGQGQQTRQ 433
Query  95   --QLQQQQQQQQ-QQILQ-QILQQQLIPCRDVVLQQPNIAHASSQVSQQSYQLLQQLCCQ 150
              QL+Q QQ  Q QQ  Q Q L+Q   P +      P   + S Q  QQ  Q  Q    Q
Sbjct  434  GQQLEQGQQPGQGQQTRQGQQLEQGQQPGQGQQGYYPTSPQQSGQ-GQQPGQSQQPGQGQ 492
Query  151  Q-LWQTPEQSRCQAIHNVIHAIILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVS 209
            Q  + +  Q   Q ++    A + +  Q +  Q+QQ  Q QQ +Q QQ  Q QQ     S
Sbjct  493  QGYYSSSLQQPGQGLQGHYPASLQQPGQGHPGQRQQPGQGQQPEQGQQPGQGQQGYYPTS 552
Query  210  YQQPQQ--QYPSGQGSFQPSQQNPQAQGFVQPQQLPQ 244
             QQP Q  Q   GQ  + P+      QG  QP Q  Q
Sbjct  553  PQQPGQGKQLGQGQQGYYPTSPQQPGQG-QQPGQGQQ 588

Sequence Alignment: 45. Allergen Name: Tri a glutenin Sequence ID: CAA31396

 Score = 38.0 bits 285,  Expect = 0.001
 Identities = 91/224 40%, Positives = 112/224 50%, Gaps = 32/224 14%
Query  14   SQQQP----QEQVPLVQQQQFLGQQQQHFPG-QQQPFPPQQ---PYPQPQPFLPQ---LP 62
            SQQQP    Q + P  QQQ   GQQ  H+P  QQQP   QQ   P  Q +P   Q   +P
Sbjct  283  SQQQPGQGQQGHYPASQQQPGQGQQG-HYPASQQQPGQGQQGHYPASQQEPGQGQQGQIP 341
Query  63   YPQPQPFPPQQS-YP----QP----QPQYPQPQQPISQQQAQLQQQQQQQQQQILQQILQ 113
              Q QP   QQ  YP    QP    Q +YP   Q + Q Q   Q  Q+QQ  Q  Q    
Sbjct  342  ASQQQPGQGQQGHYPASLQQPGQGQQGHYPTSLQQLGQGQQTGQPGQKQQPGQGQQTGQG 401
Query  114  QQLIPCRDVVLQQPNIAHASSQVS--QQSYQLLQQLCCQQ-LWQTPEQSRCQAIHNVIHA 170
            QQ  P ++   QQP   +     +  QQ  Q  QQ   QQ  + T  Q   Q  +    A
Sbjct  402  QQ--PEQE---QQPGQGQQGYYPTSLQQPGQGQQQGQGQQGYYPTSLQQPGQGQQGHYPA 456
Query  171  IILHHQQQQQQQQQQQQQQQQQQQQQQQQQQQQPSSQVSYQQPQQ--QYPSGQGSFQPSQ 228
             + +  Q Q  Q+QQ  Q Q+ +Q +Q  Q QQ     S QQP Q  Q   GQ  + P+ 
Sbjct  457  SLQQPGQGQPGQRQQPGQGQHPEQGKQPGQGQQGYYPTSPQQPGQGQQLGQGQQGYYPTS 516
Query  229  QNPQAQGFVQPQQLPQ 244
                 QG  QP Q  Q
Sbjct  517  PQQPGQG-QQPGQGQQ 531

Sequence Alignment: 46. Allergen Name: Tri a gliadin Sequence ID: CAA28208

 Score = 34.3 bits 246,  Expect = 0.003
 Identities = 45/95 47%, Positives = 57/95 60%, Gaps = 4/95 4%
Query  182  QQQQQQQQQQQQQQQQQQQQQQPSSQ--VSYQQPQQQYPSGQGSFQPSQQNPQAQG--FV 237
            Q QQQQ    +Q  QQQ    QP     +S  QPQQQ    Q   QP QQ   AQ   F+
Sbjct  48   QNQQQQVVFFEQITQQQISTFQPLQIFILSVSQPQQQQSQQQLGQQPQQQQQLAQQGTFL 107
Query  238  QPQQLPQFEEIRNLALQTLPAMCNVYIPPYCSTTIAPFG 276
            QPQQ+ Q+E + ++AL+TLP+MC V +P   +TT  PFG
Sbjct  108  QPQQVAQLELMTSIALRTLPSMCRVNVPLSRTTTSVPFG 146

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.