The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

VTCTPTELSPCLGAITGGSPPSSVCCQKLRAQKPCLCNYIKNPALRTYVNSPGARRVASS
CGVPLPSC
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A509ZX51 Ara h 16.0101 68 492 80.1 5.9e-18
XP_018847114 Jug r 8.0201 92 367 62.4 1.7e-12
XP_018816661 Jug r 8.0101 96 356 60.9 5.1e-12
A0A3Q7F7X3 Sola l 6.0101 94 337 58.1 3.4e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ara h 16.0101 Sequence ID: A0A509ZX51

 Score = 80.1 bits 492,  Expect = 6e-18
 Identities = 68/68 100%, Positives = 68/68 100%, Gaps = 0/68 0%
Query  1    VTCTPTELSPCLGAITGGSPPSSVCCQKLRAQKPCLCNYIKNPALRTYVNSPGARRVASS 60
            VTCTPTELSPCLGAITGGSPPSSVCCQKLRAQKPCLCNYIKNPALRTYVNSPGARRVASS
Sbjct  1    VTCTPTELSPCLGAITGGSPPSSVCCQKLRAQKPCLCNYIKNPALRTYVNSPGARRVASS 60
Query  61   CGVPLPSC 68
            CGVPLPSC
Sbjct  61   CGVPLPSC 68

Sequence Alignment: 2. Allergen Name: Jug r 8.0201 Sequence ID: XP_018847114

 Score = 62.4 bits 367,  Expect = 2e-12
 Identities = 43/68 63%, Positives = 57/68 83%, Gaps = 0/68 0%
Query  1    VTCTPTELSPCLGAITGGSPPSSVCCQKLRAQKPCLCNYIKNPALRTYVNSPGARRVASS 60
            VTC PT+LSPC+GAIT  +PPSS+CC K++ QKPCLC Y+KNP L+ +V+SP AR+VA++
Sbjct  25   VTCNPTQLSPCVGAITSSNPPSSLCCSKIKEQKPCLCQYLKNPNLKKFVDSPNARKVANT 84
Query  61   CGVPLPSC 68
            CG P+P C
Sbjct  85   CGTPFPKC 92

Sequence Alignment: 3. Allergen Name: Jug r 8.0101 Sequence ID: XP_018816661

 Score = 60.9 bits 356,  Expect = 5e-12
 Identities = 47/68 69%, Positives = 53/68 77%, Gaps = 0/68 0%
Query  1    VTCTPTELSPCLGAITGGSPPSSVCCQKLRAQKPCLCNYIKNPALRTYVNSPGARRVASS 60
            VTC  TELSPCL AI   + PS+ CCQKLR QKPCLC Y KNP L+ Y+NSPGA++VASS
Sbjct  29   VTCNYTELSPCLAAIVSPAKPSATCCQKLREQKPCLCVYYKNPNLKQYINSPGAKKVASS 88
Query  61   CGVPLPSC 68
            CGV LP C
Sbjct  89   CGVSLPKC 96

Sequence Alignment: 4. Allergen Name: Sola l 6.0101 Sequence ID: A0A3Q7F7X3

 Score = 58.1 bits 337,  Expect = 3e-11
 Identities = 40/67 59%, Positives = 53/67 79%, Gaps = 0/67 0%
Query  2    TCTPTELSPCLGAITGGSPPSSVCCQKLRAQKPCLCNYIKNPALRTYVNSPGARRVASSC 61
            TC+ ++LSPCLGAI GG+ PS  CC +L+ Q+PC+C ++K+P LR YVNSP AR+VA  C
Sbjct  28   TCSASQLSPCLGAIQGGTAPSQDCCARLKNQQPCICGFMKDPNLRQYVNSPNARKVAGQC 87
Query  62   GVPLPSC 68
            GV +PSC
Sbjct  88   GVSIPSC 94

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.