The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS
KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL
SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY
ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN
KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET
DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE
LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT
LSELTPVYFYISKGADGRAETHFCADQTRFAFLSGTINLSL
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA01954 Lyc e 2.0101 461 3211 738.2 2e-214
Q547Q0 Sola l 2.0101 553 3211 738.2 2.5e-214
AAL75449 Lyc e 2.0101 553 3211 738.2 2.5e-214
AAB30874 Lyc e 2.0102 636 3112 715.6 1.8e-207
Q8RVW4 Sola l 2.0201 636 3107 714.5 4e-207
AAL75450 Lyc e 2.0102 636 3107 714.5 4e-207
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lyc e 2.0101 Sequence ID: BAA01954

 Score = 738.2 bits 3211,  Expect = 2e-214
 Identities = 461/461 100%, Positives = 461/461 100%, Gaps = 0/461 0%
Query  1    YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 60
            YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS
Sbjct  1    YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 60
Query  61   KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 120
            KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL
Sbjct  61   KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 120
Query  121  SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY 180
            SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY
Sbjct  121  SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY 180
Query  181  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 240
            ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN
Sbjct  181  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 240
Query  241  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 300
            KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET
Sbjct  241  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 300
Query  301  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 360
            DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE
Sbjct  301  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 360
Query  361  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 420
            LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT
Sbjct  361  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 420
Query  421  LSELTPVYFYISKGADGRAETHFCADQTRFAFLSGTINLSL 461
            LSELTPVYFYISKGADGRAETHFCADQTRFAFLSGTINLSL
Sbjct  421  LSELTPVYFYISKGADGRAETHFCADQTRFAFLSGTINLSL 461

Sequence Alignment: 2. Allergen Name: Sola l 2.0101 Sequence ID: Q547Q0

 Score = 738.2 bits 3211,  Expect = 3e-214
 Identities = 461/461 100%, Positives = 461/461 100%, Gaps = 0/461 0%
Query  1    YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 60
            YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS
Sbjct  93   YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 152
Query  61   KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 120
            KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL
Sbjct  153  KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 212
Query  121  SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY 180
            SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY
Sbjct  213  SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY 272
Query  181  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 240
            ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN
Sbjct  273  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 332
Query  241  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 300
            KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET
Sbjct  333  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 392
Query  301  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 360
            DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE
Sbjct  393  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 452
Query  361  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 420
            LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT
Sbjct  453  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 512
Query  421  LSELTPVYFYISKGADGRAETHFCADQTRFAFLSGTINLSL 461
            LSELTPVYFYISKGADGRAETHFCADQTRFAFLSGTINLSL
Sbjct  513  LSELTPVYFYISKGADGRAETHFCADQTRFAFLSGTINLSL 553

Sequence Alignment: 3. Allergen Name: Lyc e 2.0101 Sequence ID: AAL75449

 Score = 738.2 bits 3211,  Expect = 3e-214
 Identities = 461/461 100%, Positives = 461/461 100%, Gaps = 0/461 0%
Query  1    YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 60
            YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS
Sbjct  93   YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 152
Query  61   KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 120
            KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL
Sbjct  153  KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 212
Query  121  SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY 180
            SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY
Sbjct  213  SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY 272
Query  181  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 240
            ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN
Sbjct  273  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 332
Query  241  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 300
            KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET
Sbjct  333  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 392
Query  301  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 360
            DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE
Sbjct  393  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 452
Query  361  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 420
            LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT
Sbjct  453  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 512
Query  421  LSELTPVYFYISKGADGRAETHFCADQTRFAFLSGTINLSL 461
            LSELTPVYFYISKGADGRAETHFCADQTRFAFLSGTINLSL
Sbjct  513  LSELTPVYFYISKGADGRAETHFCADQTRFAFLSGTINLSL 553

Sequence Alignment: 4. Allergen Name: Lyc e 2.0102 Sequence ID: AAB30874

 Score = 715.6 bits 3112,  Expect = 2e-207
 Identities = 444/449 98%, Positives = 448/449 99%, Gaps = 0/449 0%
Query  1    YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 60
            YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS
Sbjct  93   YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 152
Query  61   KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 120
            KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL
Sbjct  153  KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 212
Query  121  SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY 180
            SDPLLLDWVK+KGNPVLVPPPGIGVKDFRDPTT WTGPQNGQWLLTIGSKIGKTGVALVY
Sbjct  213  SDPLLLDWVKLKGNPVLVPPPGIGVKDFRDPTTRWTGPQNGQWLLTIGSKIGKTGVALVY 272
Query  181  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 240
            ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGL+TSYNGPGVKHVLKASLDDN
Sbjct  273  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLETSYNGPGVKHVLKASLDDN 332
Query  241  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 300
            KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET
Sbjct  333  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 392
Query  301  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 360
            DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE
Sbjct  393  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 452
Query  361  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 420
            LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT
Sbjct  453  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 512
Query  421  LSELTPVYFYISKGADGRAETHFCADQTR 449
            LS++TPVYFYISKGADGRAETHFCADQTR
Sbjct  513  LSDVTPVYFYISKGADGRAETHFCADQTR 541

Sequence Alignment: 5. Allergen Name: Sola l 2.0201 Sequence ID: Q8RVW4

 Score = 714.5 bits 3107,  Expect = 4e-207
 Identities = 444/449 98%, Positives = 446/449 99%, Gaps = 0/449 0%
Query  1    YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 60
            YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS
Sbjct  93   YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 152
Query  61   KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 120
            KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQI+MLYTGDTDDYVQVQNLAYPANL
Sbjct  153  KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIIMLYTGDTDDYVQVQNLAYPANL 212
Query  121  SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY 180
            SDPLLLDWVKFK NPVLVPPPGIGVKDFRDP TAWTGPQNGQWLLTIGSKIGKTGVALV 
Sbjct  213  SDPLLLDWVKFKANPVLVPPPGIGVKDFRDPITAWTGPQNGQWLLTIGSKIGKTGVALVC 272
Query  181  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 240
            ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN
Sbjct  273  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 332
Query  241  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 300
            KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPK+ERRVLWGWIGET
Sbjct  333  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKRERRVLWGWIGET 392
Query  301  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 360
            DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE
Sbjct  393  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 452
Query  361  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 420
            LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT
Sbjct  453  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 512
Query  421  LSELTPVYFYISKGADGRAETHFCADQTR 449
            LSELTPVYFYISKGADGRAETHFCADQTR
Sbjct  513  LSELTPVYFYISKGADGRAETHFCADQTR 541

Sequence Alignment: 6. Allergen Name: Lyc e 2.0102 Sequence ID: AAL75450

 Score = 714.5 bits 3107,  Expect = 4e-207
 Identities = 444/449 98%, Positives = 446/449 99%, Gaps = 0/449 0%
Query  1    YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 60
            YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS
Sbjct  93   YAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVS 152
Query  61   KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANL 120
            KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQI+MLYTGDTDDYVQVQNLAYPANL
Sbjct  153  KDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIIMLYTGDTDDYVQVQNLAYPANL 212
Query  121  SDPLLLDWVKFKGNPVLVPPPGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGVALVY 180
            SDPLLLDWVKFK NPVLVPPPGIGVKDFRDP TAWTGPQNGQWLLTIGSKIGKTGVALV 
Sbjct  213  SDPLLLDWVKFKANPVLVPPPGIGVKDFRDPITAWTGPQNGQWLLTIGSKIGKTGVALVC 272
Query  181  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 240
            ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN
Sbjct  273  ETSNFTSFKLLDGVLHAVPGTGMWECVDFYPVSTKKTNGLDTSYNGPGVKHVLKASLDDN 332
Query  241  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKKERRVLWGWIGET 300
            KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPK+ERRVLWGWIGET
Sbjct  333  KQDHYAIGTYDLGKNKWTPDNPELDCGIGLRLDYGKYYASKTFYDPKRERRVLWGWIGET 392
Query  301  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 360
            DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE
Sbjct  393  DSESADLQKGWASVQSIPRTVLYDKKTGTHLLQWPVEEIESLRVGDPTVKQVDLQPGSIE 452
Query  361  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 420
            LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT
Sbjct  453  LLRVDSAAELDIEASFEVDKVALQGIIEADHVGFSCSTSGGAASRGILGPFGVIVIADQT 512
Query  421  LSELTPVYFYISKGADGRAETHFCADQTR 449
            LSELTPVYFYISKGADGRAETHFCADQTR
Sbjct  513  LSELTPVYFYISKGADGRAETHFCADQTR 541

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.