The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP
Allergen Info Description
Allergen ID 40
Allergen Scientific Name Aln g 1
Allergen Species - Systematic Name Alnus glutinosa
Allergen Species - Common Name alder
Allergen Common source tree
Allergen Common name Fagales
Allergen Keywords homolog: pathogenesis related protein PR10
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Aln g 1 - References
ID Reference
Pubmed ID: 1460197
Breiteneder H, Ferreira F, Reikerstorfer A, Duchene M, Valenta R, Hoffmann-Sommergruber K, Ebner C, Breitenbach M, Kraft D, Scheiner O. Complementary DNA cloning and expression in Escherichia coli of Aln g I, the major allergen in pollen of alder (Alnus glutinosa). J Allergy Clin Immunol. 1992 Dec;90(6 Pt 1):909-17.
Aln g 1 - Protein Sequences
Source Link to source
SwissProt P38948
GenBank 261407
GenBank 7430710
Aln g 1 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
6 GetModel Model Pic Model Pic Model Pic Model Pic Click here
305 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Aln g 1 - Sequence Search :
Sequence Header Sequence
Aln g 1
SDAP Sequence ID: 305
SDAP Allergen ID: 40
MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Aln g 1
SDAP Sequence ID: 508
SDAP Allergen ID: 40
MNLFSALSLDTLVLLAIILVLLYRYGTYTHGLFKKQGIPGPKPLPFLGTVLNYYKGLWKFDMECYEKYGKTWGLFDGQIPLFVITDPETIKNVLVKECFSVFTNRQDFFPVGIMSKSISLAKDEEWKRYRALLSPTFTSGNLKEMFPVIEQYGDILVKYLRQEAEKGKPVAVKDVLGAYSMDVIISTTFGVNIDSLNNPEDPFVENAKKVLRFDYFDPLSLSVALFPFLTPIYEMLNICMFPKDSIEFFKKFVDRMTENRLDSKQKHRVDFIYLMMEAYNKSKDKDSHKALSEIEITAQSIIFIFAGYETTSSILSFTVYSLATHPDIQKKLQEEIDEALPNKAPPTYDTVMAMEYLDMVLNETLRLYPITNRLQRVCKKDVEINGIYIPKGSTVIIPSYVLHHDPQHWPEPEEFQPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALIKVLQNFSFQPCKETQIPLKLSRELLLQPVKPIVLKVVPRDAVITGA
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Aln g 1
SDAP Sequence ID: 6
SDAP Allergen ID: 40
GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Aln g 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Aln g 1 91.45 0.91 3TJS_A 71.074 484 504 21 - 504 1 - 483 0 742 Download (SI: 508)
Aln g 1 95.55 0.82 4A84_A 81.132 159 159 1 - 159 1 - 159 0 268 Download (SI: 6)
Aln g 1 93.85 0.81 7MXL_C 81.25 160 160 1 - 160 1 - 160 0 271 Download (SI: 305)
Aln g 1 - Alphafold Theoretical Model Structure
Model Structure
6_relaxed_rank_1_model_1.pdb


Coverage Plddt
Aln g 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P38948 Click here to process the data
261407 Click here to process the data
7430710 Click here to process the data
Aln g 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
6 40 2 154 1 154 PF00407 Bet_v_1 Domain CL0209 Pathogenesis-related protein Bet v 1 family
305 40 1 155 1 155 PF00407 Bet_v_1 Domain CL0209 Pathogenesis-related protein Bet v 1 family
508 40 39 493 38 494 PF00067 p450 Domain No_clan Cytochrome P450
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Aln g 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.