The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 132
Allergen Scientific Name Alt a 1
Allergen Species - Systematic Name Alternaria alternata
Allergen Species - Common Name
Allergen Common source fungi (moulds)
Allergen Common name Ascomycota Dothidiales
Allergen Keywords N
Allergen IUIS (Yes=1, No=0) 1

Alt a 1 : There are iso allergen in the table! Click on each iso-allergen for more information.

ID Allergen Name
1 Alt a 1.0101
2 Alt a 1.0102
Alt a 1 - References
ID Reference
Pubmed ID: 12668200
Kurup VP, Vijay HM, Kumar V, Castillo L, Elms N, IgE binding synthetic peptides of Alt a 1, a major allergen of Alternaria alternata. Peptides. 2003 Feb;24(2):179-85.
Pubmed ID: 9647269
Rosenthal D, Hu F, Pacheco F, Landuyt J, Barnes C, Portnoy J, Northern blot identification of mRNA containing sequence for protein allergen, Alt a1, in eight strains of Alternaria alternata. Ann Allergy Asthma Immunol. 1998 Jun;80(6):471-5.
Pubmed ID: 8957113
De Vouge MW, Thaker AJ, Curran IH, Zhang L, Muradia G, Rode H, Vijay HM, Isolation and expression of a cDNA clone encoding an Alternaria alternata Alt a 1 subunit. Int Arch Allergy Immunol. 1996 Dec;111(4):385-95.
Pubmed ID: 7580290
Zhang L, Curran IH, Muradia G, De Vouge MW, Rode H, Vijay HM, N-terminus of a major allergen, Alt a I, of Alternaria alternata defined to be an epitope. Int Arch Allergy Immunol. 1995 Nov;108(3):254-9.
Alt a 1 - Protein Sequences
Source Link to source
SwissProt P79085
Alt a 1 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
132 306 3V0R 2011-12-08 X-ray diffraction resolution 1.90 A crystal structure of Alternaria alternata allergen Alt a 1
3V0R.pdb


Alt a 1 - Sequence Search :
Sequence Header Sequence
Alt a 1
SDAP Sequence ID: 8
SDAP Allergen ID: 132
MQFTTIASLFAAAGLAAAAPLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Alt a 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Alt a 1 87.4 0.7 3V0R_A 99.248 133 157 25 - 157 1 - 133 0 278 Download (SI: 8)
Alt a 1 - Alphafold Theoretical Model Structure
Model Structure
8_relaxed_rank_1_model_2.pdb


Coverage Plddt
Alt a 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P79085 Click here to process the data
Alt a 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
8 132 42 140 42 140 PF16541 AltA1 Domain No_clan Alternaria alternata allergen 1
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Alt a 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 41-50 KISEFYGRKP IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 54-63 YYNSLGFNIK IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
8_relaxed_rank_1_model_2.pdb



Epitope Reference ( ID 20): V. P. Kurup, H. M. Vijay, V. Kumar, L. Castillo, and N. Elms, IgE binding synthetic peptides of Alt a 1, a major allergen of Alternaria alternata, Peptides 2003, 00, 00-00.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.