The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 1067
Allergen Scientific Name Ani s 8.0101
Allergen Species - Systematic Name Anisakis simplex
Allergen Species - Common Name nematode
Allergen Common source others
Allergen Common name
Allergen Keywords SXP/RAL-2 family protein
Allergen IUIS (Yes=1, No=0) 1
Ani s 8.0101 - References
ID Reference
No reference found!
Ani s 8.0101 - Protein Sequences
Source Link to source
GenBank 155676680
GenBank 155676682
GenBank 155676684
GenBank 155676686
GenBank 155676688
GenBank 155676690
GenBank 155676692
GenBank 155676694
GenBank 155676696
GenBank 155676698
Ani s 8.0101 - Sequence Search :
Sequence Header Sequence
Ani s 8.0101
SDAP Sequence ID: 962
SDAP Allergen ID: 1067
MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQFVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLAAKHDKIVQTFESLPPAVKEELNKLNQQGQS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ani s 8.0101
SDAP Sequence ID: 963
SDAP Allergen ID: 1067
MRVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQFVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLAAKHDKIVQTFESLPPAVKEELNKLNQQGQS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ani s 8.0101
SDAP Sequence ID: 964
SDAP Allergen ID: 1067
MKVLFFVAAVVADSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQFVNDHPAIKDAYEAEKKEVLAAQQATEEEHKKLVAALPPDAQKADAELTAIADDASLTLAAKHDKIVQTFESLPPAVKEELNKLNQQGQS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ani s 8.0101
SDAP Sequence ID: 965
SDAP Allergen ID: 1067
MKVLFFVAAVVAVPLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQFVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLAAKHDKIVQTFESLPPAVKEELNKLNQQGQS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ani s 8.0101
SDAP Sequence ID: 966
SDAP Allergen ID: 1067
MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAYAALAQTFKDDTDKQVEDAVQQFVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLAAKHDKIVQTFESLPPAVKEELNKLNQQGQS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ani s 8.0101
SDAP Sequence ID: 967
SDAP Allergen ID: 1067
MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFRDDTDKQVEDAVQQFVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLAAKHDKIVQTFESLPPAVKEELNKLNQQGQS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ani s 8.0101
SDAP Sequence ID: 968
SDAP Allergen ID: 1067
MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQFANDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTATADDASLTLAAKHDKIVQTFESLPPAVKEELNKLNQQGQS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ani s 8.0101
SDAP Sequence ID: 969
SDAP Allergen ID: 1067
MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQFVNNHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLAAKHDKIVQTFESLPPAVKEELNKLNQQGQS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ani s 8.0101
SDAP Sequence ID: 970
SDAP Allergen ID: 1067
MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQFVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAESTAIADDASLTLAAKHDKIVQTFESLPPAVKEELNKLNQQGQS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ani s 8.0101
SDAP Sequence ID: 971
SDAP Allergen ID: 1067
MKVLFFVAAVVAVSLAQDQGPPPLPKFLDGADQATKDAFAALAQTFKDDTDKQVEDAVQQFVNDHPAIKDAYEAEKKEVLAAQQAAEEEHKKLVAALPPDAQKADAELTAIADDASLTLAAKHDKIVQTFESLPPAVKEELDKLNQQGQS
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Ani s 8.0101 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Ani s 8.0101 83.4 0.72 2MAR_A 38.583 127 150 18 - 143 1 - 126 0.0000000000000511 65.9 Download (SI: 969)
Ani s 8.0101 82.95 0.73 2MAR_A 38.583 127 150 18 - 143 1 - 126 0.0000000000000968 65.1 Download (SI: 971)
Ani s 8.0101 80.3 0.7 2MAR_A 38.583 127 150 18 - 143 1 - 126 0.000000000000126 64.7 Download (SI: 965)
Ani s 8.0101 81.7 0.72 2MAR_A 38.583 127 150 18 - 143 1 - 126 0.000000000000109 65.1 Download (SI: 967)
Ani s 8.0101 80.55 0.7 2MAR_A 38.583 127 150 18 - 143 1 - 126 0.000000000000122 64.7 Download (SI: 963)
Ani s 8.0101 81 0.71 2MAR_A 38.583 127 150 18 - 143 1 - 126 0.000000000000104 65.1 Download (SI: 964)
Ani s 8.0101 82.65 0.73 2MAR_A 38.583 127 150 18 - 143 1 - 126 0.000000000000121 64.7 Download (SI: 962)
Ani s 8.0101 78.2 0.67 2MAR_A 37.795 127 150 18 - 143 1 - 126 0.00000000000142 62 Download (SI: 970)
Ani s 8.0101 81.3 0.72 2MAR_A 37.795 127 150 18 - 143 1 - 126 0.000000000000377 63.5 Download (SI: 966)
Ani s 8.0101 81.35 0.72 2MAR_A 39.231 130 150 18 - 143 1 - 126 0.00000000000204 61.6 Download (SI: 968)
Ani s 8.0101 - Alphafold Theoretical Model Structure
Model Structure
971_relaxed_rank_1_model_1.pdb


Coverage Plddt
Ani s 8.0101 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
155676680 Click here to process the data
155676682 Click here to process the data
155676684 Click here to process the data
155676686 Click here to process the data
155676688 Click here to process the data
155676690 Click here to process the data
155676692 Click here to process the data
155676694 Click here to process the data
155676696 Click here to process the data
155676698 Click here to process the data
Ani s 8.0101 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
962 1067 37 138 34 145 PF02520 ANIS5_cation-bd Domain No_clan SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
963 1067 37 138 34 145 PF02520 ANIS5_cation-bd Domain No_clan SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
964 1067 37 138 34 145 PF02520 ANIS5_cation-bd Domain No_clan SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
965 1067 37 138 34 145 PF02520 ANIS5_cation-bd Domain No_clan SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
966 1067 38 138 34 145 PF02520 ANIS5_cation-bd Domain No_clan SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
967 1067 38 138 34 145 PF02520 ANIS5_cation-bd Domain No_clan SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
968 1067 37 138 34 145 PF02520 ANIS5_cation-bd Domain No_clan SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
969 1067 37 138 34 145 PF02520 ANIS5_cation-bd Domain No_clan SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
970 1067 37 138 34 145 PF02520 ANIS5_cation-bd Domain No_clan SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
971 1067 37 138 34 144 PF02520 ANIS5_cation-bd Domain No_clan SXP/RAL-2 family protein Ani s 5-like, metal-binding domain
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Ani s 8.0101 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.