The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 149
Allergen Scientific Name Asp f 1
Allergen Species - Systematic Name Aspergillus fumigatus
Allergen Species - Common Name
Allergen Common source fungi (moulds)
Allergen Common name Ascomycota Eurotiales
Allergen Keywords Restrictocin; Ribonuclease mitogillin; EC 3.1.27
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Asp f 1 - References
ID Reference
Pubmed ID: 15138181
Madan T, Priyadarsiny P, Vaid M, Kamal N, Shah A, Haq W, Katti SB, Sarma PU, Use of a synthetic peptide epitope of Asp f 1, a major allergen or antigen of Aspergillus fumigatus, for improved immunodiagnosis of allergic bronchopulmonary aspergillosis. Clin Diagn Lab Immunol. 2004 May;11(3):552-8.
Pubmed ID: 9864052
Kurup VP, Banerjee B, Murali PS, Greenberger PA, Krishnan M, Hari V, Fink JN, Immunodominant peptide epitopes of allergen, Asp f 1 from the fungus Aspergillus fumigatus. Peptides. 1998;19(9):1469-77.
Asp f 1 - Protein Sequences
Source Link to source
SwissProt P04389
GenBank 166486
GenBank 250902
Asp f 1 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
149 156 1AQZ 04-AUG-97 X-ray diffraction resolution 1.7 A inorganic phosphate group at the active site
1AQZ.pdb


Asp f 1 - Sequence Search :
Sequence Header Sequence
Asp f 1
SDAP Sequence ID: 327
SDAP Allergen ID: 149
MVAIKNLFLLAATAVSVLAAPSPLDARATWTCINQQLNPKTNKWEDKRLLYNQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Asp f 1
SDAP Sequence ID: 328
SDAP Allergen ID: 149
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Asp f 1
SDAP Sequence ID: 38
SDAP Allergen ID: 149
MVAIKNLFLLAATAVSVLAAPSPLDARATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Asp f 1 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Asp f 1 90 0.81 1JBR_A 100 149 176 28 - 176 1 - 149 0 317 Download (SI: 38)
Asp f 1 89.75 0.75 1JBR_A 99.329 149 176 28 - 176 1 - 149 0 315 Download (SI: 327)
Asp f 1 96.65 0.88 1JBR_A 100 149 149 1 - 149 1 - 149 0 313 Download (SI: 328)
Asp f 1 - Alphafold Theoretical Model Structure
Model Structure
38_relaxed_rank_1_model_2.pdb


Coverage Plddt
Asp f 1 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P04389 Click here to process the data
166486 Click here to process the data
250902 Click here to process the data
Asp f 1 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Asp f 1 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
1 30-39 WTCINQQLNP IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
2 40-49 KTNKWEDKRL IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
3 51-60 YNQAKAESNS IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
4 67-76 DGKTGSSTPH IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
5 77-86 WFTNGYDGNG IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
6 91-100 GRTPIKFGKA IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
7 102-111 CDRPPKHSQN IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
8 114-123 GKDDHYLLEF IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
9 123-132 FPTFPDGHDY IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
10 143-152 PGPARVIYTY IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
11 148-157 VIYTYPNKVF IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
12 159-168 GIVAHQRGNQ IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
13 167-176 NQGDLRLCSH IgE Click here to find exact epitope Click here to find similar epitopes Click here for Cross-React search
38_relaxed_rank_1_model_2.pdb



Epitope Reference ( ID 16): V. P. Kurup, B. Banerjee, P. S. Murali, P. A. Greenberger, M. Krishnan, V. Hari, and J. N. Fink, Immunodominant peptide epitopes of allergen, Asp f 1 from the fungus Aspergillus fumigatus, Peptides 1998, 19, 1469-1477.
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.