The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 114
Allergen Scientific Name Bos d 4
Allergen Species - Systematic Name Bos domesticus
Allergen Species - Common Name domestic cattle
Allergen Common source foods
Allergen Common name
Allergen Keywords alpha-lactalbumin; Lactose synthase B protein
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Bos d 4 - References
ID Reference
Pubmed ID: 3443304
Hurley WL, Schuler LA. Molecular cloning and nucleotide sequence of a bovine alpha-lactalbumin cDNA. Gene. 1987;61(1):119-22.
Pubmed ID: 2687274
Wang M, Scott WA, Rao KR, Udey J, Conner GE, Brew K. Recombinant bovine alpha-lactalbumin obtained by limited proteolysis of a fusion protein expressed at high levels in Escherichia coli. J Biol Chem. 1989 Dec 15;264(35):21116-21.
Pubmed ID: 3120795
Vilotte JL, Soulier S, Mercier JC, Gaye P, Hue-Delahaie D, Furet JP. Complete nucleotide sequence of bovine alpha-lactalbumin gene: comparison with its rat counterpart. Biochimie. 1987 Jun-Jul;69(6-7):609-20.
Pubmed ID: 5532231
Brew K, Castellino FJ, Vanaman TC, Hill RL. The complete amino acid sequence of bovine alpha-lactalbumin. J Biol Chem. 1970 Sep 10;245(17):4570-82.
Pubmed ID: 6715332
Shewale JG, Sinha SK, Brew K. Evolution of alpha-lactalbumins. The complete amino acid sequence of the alpha-lactalbumin from a marsupial (Macropus rufogriseus) and corrections to regions of sequence in bovine and goat alpha-lactalbumins. J Biol Chem. 1984 Apr 25;259(8):4947-56.
Pubmed ID: 8482536
Bleck GT, Bremel RD. Sequence and single-base polymorphisms of the bovine alpha-lactalbumin 5'-flanking region. Gene. 1993 Apr 30;126(2):213-8.
Pubmed ID: 8805552
Pike AC, Brew K, Acharya KR. Crystal structures of guinea-pig, goat and bovine alpha-lactalbumin highlight the enhanced conformational flexibility of regions that are significant for its action in lactose synthase. Structure. 1996 Jun 15;4(6):691-703.
Pubmed ID: 1840525
Viaene A, Volckaert G, Joniau M, De Baetselier A, Van Cauwelaert F. Efficient expression of bovine alpha-lactalbumin in Saccharomyces cerevisiae. Eur J Biochem. 1991 Dec 5;202(2):471-7.
Bos d 4 - Protein Sequences
Source Link to source
SwissProt P00711
GenBank 295774
SwissProt Q28049
Bos d 4 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
114 21 1HFZ 13-JUN-96 X-ray diffraction resolution 2.3 A inserted (MET 1X), mutant M90V
114 279 2G4N 2006-02-22 X-ray diffraction resolution 2.30 A
2G4N.pdb


Bos d 4 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
71 GetModel Model Pic Model Pic Model Pic Model Pic Click here
564 GetModel Model Pic Model Pic Model Pic Model Pic Click here
808 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Bos d 4 - Sequence Search :
Sequence Header Sequence
Bos d 4
SDAP Sequence ID: 564
SDAP Allergen ID: 114
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 4
SDAP Sequence ID: 71
SDAP Allergen ID: 114
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 4
SDAP Sequence ID: 808
SDAP Allergen ID: 114
EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 4 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Bos d 4 96.15 0.88 1F6R_A 99.187 123 123 1 - 123 1 - 123 0 251 Download (SI: 808)
Bos d 4 90.8 0.75 1F6R_A 100 123 142 20 - 142 1 - 123 0 256 Download (SI: 71)
Bos d 4 90.6 0.75 1F6R_A 99.187 123 142 20 - 142 1 - 123 0 254 Download (SI: 564)
Bos d 4 - Alphafold Theoretical Model Structure
Model Structure
808_relaxed_rank_1_model_5.pdb


Coverage Plddt
Bos d 4 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P00711 Click here to process the data
295774 Click here to process the data
Q28049 Click here to process the data
Bos d 4 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
71 114 21 139 20 139 PF00062 Lys Domain CL0037 C-type lysozyme/alpha-lactalbumin family
564 114 21 139 20 139 PF00062 Lys Domain CL0037 C-type lysozyme/alpha-lactalbumin family
808 114 2 120 1 120 PF00062 Lys Domain CL0037 C-type lysozyme/alpha-lactalbumin family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Bos d 4 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.