The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology



SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Info Description
Allergen ID 115
Allergen Scientific Name Bos d 5
Allergen Species - Systematic Name Bos domesticus
Allergen Species - Common Name domestic cattle
Allergen Common source foods
Allergen Common name
Allergen Keywords beta-lactoglobulin; Beta-LG
Allergen IUIS (Yes=1, No=0) 1
ID Allergen Name
Bos d 5 - References
ID Reference
Pubmed ID: 2701948
Alexander LJ, Hayes G, Pearse MJ, Beattie CW, Stewart AF, Willis IM, Mackinlay AG. Complete sequence of the bovine beta-lactoglobulin cDNA. Nucleic Acids Res. 1989 Aug 25;17(16):6739.
Pubmed ID: 4611888
Braunitzer G, Chen R, Schrank B, Stangl A. [The sequence of beta-lactoglobulin (author's transl)] Hoppe Seylers Z Physiol Chem. 1973 Aug;354(8):867-78. German.
Pubmed ID: 3443305
Jamieson AC, Vandeyar MA, Kang YC, Kinsella JE, Batt CA. Cloning and nucleotide sequence of the bovine beta-lactoglobulin gene. Gene. 1987;61(1):85-90.
Pubmed ID: 4569282
McKenzie HA, Ralston GB, Shaw DC. Location of sulfhydryl and disulfide groups in bovine -lactoglobulins and effects of urea. Biochemistry. 1972 Nov 21;11(24):4539-47.
Pubmed ID: 2340107
Godovac-Zimmermann J, Krause I, Buchberger J, Weiss G, Klostermeyer H. Genetic variants of bovine beta-lactoglobulin. A novel wild-type beta-lactoglobulin W and its primary sequence. Biol Chem Hoppe Seyler. 1990 Mar;371(3):255-60.
Pubmed ID: 1623143
Monaco HL, Zanotti G. Three-dimensional structure and active site of three hydrophobic molecule-binding proteins with significant amino acid sequence similarity. Biopolymers. 1992 Apr;32(4):457-65.
Pubmed ID: 10595563
Kuwata K, Hoshino M, Forge V, Era S, Batt CA, Goto Y. Solution structure and dynamics of bovine beta-lactoglobulin A. Protein Sci. 1999 Nov;8(11):2541-5.
Bos d 5 - Protein Sequences
Source Link to source
SwissProt P02754
GenBank 520
GenBank 162750
GenBank 162748
Bos d 5 - PDB Structure
PDB Id PDB Name PDB Entry Deposition Date Experiment Type Observation
115 13 1BEB 20-DEC-96 X-ray diffraction resolution 1.8 A
115 14 1BSO 29-AUG-98 X-ray diffraction resolution 2.23 A
115 15 1BSQ 29-AUG-98 X-ray diffraction resolution 2.22 A
115 16 1BSY 31-AUG-98 X-ray diffraction resolution 2.24 A
115 17 2BLG 29-AUG-98 X-ray diffraction resolution 2.46 A
115 18 3BLG 29-AUG-98 X-ray diffraction resolution 2.56 A
115 19 1B0O 11-NOV-98 X-ray diffraction resolution 2.50 A complex with palmitic acid
115 20 1CJ5 22-APR-99 NMR, 10 structures mutant
115 169 1GX8 29-MAR-02 X-ray diffraction resolution 2.4 A complexed with retinol
115 170 1GX9 29-MAR-02 X-ray diffraction resolution 2.34 A complexed with retinoic acid
115 171 1GXA 01-APR-02 X-ray diffraction resolution 2.35 A complexed with palmitic acid
115 190 1UZ2 03-MAR-04 X-ray diffraction resolution 1.95 A
115 208 2Q2P 2007-05-29 X-ray diffraction resolution 2.96 A
115 209 2Q39 2007-05-30 X-ray diffraction resolution 2.50 A
115 280 2AKQ 2005-08-03 X-ray diffraction resolution 3.00 A structure of bovine beta-lactoglobulin at very low ionic strength
115 281 2GJ5 2006-03-30 X-ray diffraction resolution 2.40 A complex with vitamin D3
115 282 2Q2M 2007-05-29 X-ray diffraction resolution 2.10 A
115 283 2R56 2007-09-03 X-ray diffraction resolution 2.80 A complex with IgE (heavy and light chains)
2R56.pdb


Bos d 5 - Theoretical Model Structure
Model ID PDB file PDB Snapshot PDB Snapshot 90 PDB Snapshot 180 PDB Snapshot 270 3D PDB View
563 GetModel Model Pic Model Pic Model Pic Model Pic Click here
Bos d 5 - Sequence Search :
Sequence Header Sequence
Bos d 5
SDAP Sequence ID: 316
SDAP Allergen ID: 115
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLVCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 5
SDAP Sequence ID: 562
SDAP Allergen ID: 115
NSAEPXQSLVCECL
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 5
SDAP Sequence ID: 563
SDAP Allergen ID: 115
IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 5
SDAP Sequence ID: 72
SDAP Allergen ID: 115
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
View 3D Structure Click here to view 3D model structure of allergen
Fasta Search in SDAP
Blast Swissprot database search at NCBI
Blast PDB database search at NCBI
Blast NR database search at NCBI
Bos d 5 - Statistics from Alphafold ( SI is sequence id, Best template format: PDB_ChainID)
Allergen Name pLDDT Score pTM Score Best PDB template %Seq ID Align length Seq length Query Range Sequence Range E-Value Bit Score Download Model
Bos d 5 89.1 0.77 6NKQ_A 100 178 178 1 - 178 1 - 178 0 362 Download (SI: 72)
Bos d 5 88.75 0.77 6NKQ_A 98.315 178 178 1 - 178 1 - 178 0 355 Download (SI: 316)
Bos d 5 92.9 0.85 1BSO_A 100 151 151 1 - 151 12 - 162 0 308 Download (SI: 563)
Bos d 5 66.85 0.03 1BSO_A 85.714 14 14 1 - 14 109 - 122 0.051 28.5 Download (SI: 562)
Bos d 5 - Alphafold Theoretical Model Structure
Model Structure
72_relaxed_rank_1_model_5.pdb


Coverage Plddt
Bos d 5 - Protein Sequence Properties!
Protein Sequence Protease cleavage sites PeptideCutter at ExPASy
P02754 Click here to process the data
520 Click here to process the data
162750 Click here to process the data
162748 Click here to process the data
Bos d 5 - PFAM Information
SeqID Aller ID AlnS AlnE EnvS EnvE PFAM ID Family Type Clan Description
72 115 32 170 32 173 PF00061 Lipocalin Domain CL0116 Lipocalin / cytosolic fatty-acid binding protein family
316 115 32 170 32 173 PF00061 Lipocalin Domain CL0116 Lipocalin / cytosolic fatty-acid binding protein family
563 115 5 143 5 146 PF00061 Lipocalin Domain CL0116 Lipocalin / cytosolic fatty-acid binding protein family
Where: AlnS= Alignment start position, AlnE= Alignment end position, EnvS= Envelope start position, EnvE= Envelope end position.

List of B-cell epitopes predicted by BepiPred method using a window size of 9 amino acids

Cleck here for epitopes predicted by BepiPred method
Bos d 5 - Epitope Information from published data
No. Position Epitope Sequence Epitope Type View epitope Search epitope in SDAP PD search in SDAP Cross-React search
No epitope information found!
SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.